DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and Dclk1

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_038959175.1 Gene:Dclk1 / 83825 RGDID:68437 Length:756 Species:Rattus norvegicus


Alignment Length:300 Identity:107/300 - (35%)
Similarity:164/300 - (54%) Gaps:37/300 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EEDDLLPDKDAAKGFY------AKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESG 63
            ||.|        :||.      .:|:....:|.|..:.|:.|||:.|.:|:|.|||     .:|.
  Rat   390 EESD--------EGFQIPATITERYKVGRTIGDGNFAVVKECIERSTAREYALKII-----KKSK 441

  Fly    64 ETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEK 128
            .....||::   .|:||||:|. ||.|:.|.:..:....::||.||...|:|||.:||....:|:
  Rat   442 CRGKEHMIQ---NEVSILRRVK-HPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTSKYTER 502

  Fly   129 KTRTIMRQIFEGVEYIHAKSIVHRDLKPENILL----DENHNVKITDFGFAKQLQEGEKLTNLCG 189
            ....::..:...::|:|:.:|||||:||||:|:    |.:.::|:.|||.| .:.:| .|..:||
  Rat   503 DASGMLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLA-TIVDG-PLYTVCG 565

  Fly   190 TPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHR--KQMVMLRNIMEGKYSF 252
            ||.|:|||.:      ...||..:|||||.|||.:.||.|.|||...  .|.|:...|:.|:..|
  Rat   566 TPTYVAPEII------AETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGQVDF 624

  Fly   253 TSPEWADISEDPKDLIRKCLVVDPSQRITVKEVLRHPFFN 292
            .||.|.::|:..|:||...|:|:..||.:..:||.||:.|
  Rat   625 PSPYWDNVSDSAKELINMMLLVNVDQRFSAVQVLEHPWVN 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 102/283 (36%)
S_TKc 23..291 CDD:214567 101/273 (37%)
Dclk1XP_038959175.1 DCX1_DCLK1 55..143 CDD:340660
DCX2 182..265 CDD:340589
STKc_DCKL1 399..666 CDD:271085 101/282 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.