DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and PPCK1

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_172341.1 Gene:PPCK1 / 837387 AraportID:AT1G08650 Length:284 Species:Arabidopsis thaliana


Alignment Length:276 Identity:92/276 - (33%)
Similarity:145/276 - (52%) Gaps:18/276 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMG 86
            ||:..|.:|||...||.|.....||..||.|.||..:.::..:.      .....|..::..:..
plant    14 KYQICEEIGRGRFGTVSRVYAPATGDFFACKTIDKASLSDDLDR------ACLDNEPKLMALLSY 72

  Fly    87 HPYIIDLQDVFESDAFVFLVFELC-PKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIV 150
            ||.|:.:.|:.::|:.:.:..||. |...::|.|.|..|..|.:|.:..:||.:.:.:.|...:|
plant    73 HPNIVQIHDLIDTDSTLSIFMELVHPSVSIYDRLVSSGTFFEPQTASFAKQILQALSHCHRYGVV 137

  Fly   151 HRDLKPENILLD-ENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYS--Q 212
            |||:||||||:| .|..|||.|||....|.|||....:.|||.|:|||.|.        |||  :
plant   138 HRDIKPENILVDLRNDTVKICDFGSGIWLGEGETTEGVVGTPYYVAPEVLM--------GYSYGE 194

  Fly   213 EVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPS 277
            :||:|:.||:::|:|.|.|||:......:...::.|...|.:..:..:|...||.:||.:..|.|
plant   195 KVDLWSAGVVLYTMLAGTPPFYGETAEEIFEAVLRGNLRFPTKIFRGVSSMAKDFLRKLICKDAS 259

  Fly   278 QRITVKEVLRHPFFNQ 293
            :|.:.::.||||:..:
plant   260 RRFSAEQALRHPWIQR 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 92/272 (34%)
S_TKc 23..291 CDD:214567 91/271 (34%)
PPCK1NP_172341.1 STKc_CAMK 14..272 CDD:270687 91/271 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.