DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CDPK9

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_197748.1 Gene:CDPK9 / 832424 AraportID:AT5G23580 Length:490 Species:Arabidopsis thaliana


Alignment Length:308 Identity:105/308 - (34%)
Similarity:157/308 - (50%) Gaps:35/308 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLPDKDAAKGFYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHML-- 71
            :||.|  .|.....|...::||:|...|...|..|:||::.|.|.|            |...|  
plant    10 VLPYK--TKNVEDNYFLGQVLGQGQFGTTFLCTHKQTGQKLACKSI------------PKRKLLC 60

  Fly    72 ----EATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRT 132
                :...:||.|:..:..:|.::.::..:|....|.||.|||..|||||.:......||::...
plant    61 QEDYDDVLREIQIMHHLSEYPNVVRIESAYEDTKNVHLVMELCEGGELFDRIVKRGHYSEREAAK 125

  Fly   133 IMRQIFEGVEYIHAKSIVHRDLKPENILL---DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYL 194
            :::.|...||..|:..:|||||||||.|.   ||:.::|.||||.:.....||..:.|.|:..|:
plant   126 LIKTIVGVVEACHSLGVVHRDLKPENFLFSSSDEDASLKSTDFGLSVFCTPGEAFSELVGSAYYV 190

  Fly   195 APETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWAD 259
            |||.|..:       |..|.|:|:.|||::.||.|.||||...::.:.|.|::||..|....|..
plant   191 APEVLHKH-------YGPECDVWSAGVILYILLCGFPPFWAESEIGIFRKILQGKLEFEINPWPS 248

  Fly   260 ISEDPKDLIRKCLVVDPSQRITVKEVLRHPFFNQMVLMGDRRHPAPPI 307
            |||..||||:|.|..:|.:|:|..:||.||:     ::.|:..|..|:
plant   249 ISESAKDLIKKMLESNPKKRLTAHQVLCHPW-----IVDDKVAPDKPL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 98/280 (35%)
S_TKc 23..291 CDD:214567 98/276 (36%)
CDPK9NP_197748.1 STKc_CAMK 21..279 CDD:270687 97/276 (35%)
Pkinase 22..280 CDD:278497 98/281 (35%)
PTZ00184 316..458 CDD:185504
EFh 328..387 CDD:238008
EFh 400..459 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.