DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CPK7

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_568281.1 Gene:CPK7 / 831123 AraportID:AT5G12480 Length:535 Species:Arabidopsis thaliana


Alignment Length:301 Identity:99/301 - (32%)
Similarity:159/301 - (52%) Gaps:23/301 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMG 86
            :|:....:|||.......|.:||||:::|.|.|.......:.:      :|..|:|:.|::.:..
plant    58 QYDLGREVGRGEFGITYLCTDKETGEKYACKSISKKKLRTAVD------IEDVRREVEIMKHMPK 116

  Fly    87 HPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVH 151
            ||.::.|:|.||.|..|.:|.|||..|||||.:.:....:|:....:|:.|.|.|:..|.:.::|
plant   117 HPNVVSLKDSFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIVEVVQICHKQGVMH 181

  Fly   152 RDLKPENILL---DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQE 213
            |||||||.|.   .|...:|..|||.:...:.||:...:.|:|.|:|||.|:.|       |..|
plant   182 RDLKPENFLFANKKETSALKAIDFGLSVFFKPGEQFNEIVGSPYYMAPEVLRRN-------YGPE 239

  Fly   214 VDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPSQ 278
            :|:|:.|||::.||.|.||||...:..:.:.|:.....|....|..:|:..|||:||.|..||.:
plant   240 IDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSDSAKDLVRKMLEPDPKK 304

  Fly   279 RITVKEVLRHPFFNQMVLMGDRRHPAPPIAPAQTNSRHLLQ 319
            |:|..:||.|.:     ::..::  ||.::..:|....|.|
plant   305 RLTAAQVLEHTW-----ILNAKK--APNVSLGETVKARLKQ 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 94/271 (35%)
S_TKc 23..291 CDD:214567 94/270 (35%)
CPK7NP_568281.1 STKc_CAMK 58..316 CDD:270687 94/270 (35%)
FRQ1 356..503 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.