DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CPK1

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_196107.1 Gene:CPK1 / 830366 AraportID:AT5G04870 Length:610 Species:Arabidopsis thaliana


Alignment Length:267 Identity:102/267 - (38%)
Similarity:142/267 - (53%) Gaps:20/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LGRGISSTVRRCIEKETGKEFAAKIIDLG--ATTESGETNPYHMLEATRQEISILRQVMGHPYII 91
            ||:|...|...|:||.||||||.|.|...  .|.|.        :|..|:||.|:..:.|||.:|
plant   156 LGQGQFGTTFLCVEKTTGKEFACKSIAKRKLLTDED--------VEDVRREIQIMHHLAGHPNVI 212

  Fly    92 DLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKP 156
            .::..:|....|.||.|.|..|||||.:......:|:|...:.|.|...||..|:..::||||||
plant   213 SIKGAYEDVVAVHLVMECCAGGELFDRIIQRGHYTERKAAELTRTIVGVVEACHSLGVMHRDLKP 277

  Fly   157 ENILLDENHN---VKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDIWA 218
            ||.|....|.   :|..|||.:...:..:..|::.|:|.|:|||.|:       ..|..|.|:|:
plant   278 ENFLFVSKHEDSLLKTIDFGLSMFFKPDDVFTDVVGSPYYVAPEVLR-------KRYGPEADVWS 335

  Fly   219 CGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPSQRITVK 283
            .|||::.||.|.||||...:..:...::.|...|:|..|..|||..|||:||.||.||.:|:|..
plant   336 AGVIVYILLSGVPPFWAETEQGIFEQVLHGDLDFSSDPWPSISESAKDLVRKMLVRDPKKRLTAH 400

  Fly   284 EVLRHPF 290
            :||.||:
plant   401 QVLCHPW 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 102/267 (38%)
S_TKc 23..291 CDD:214567 102/267 (38%)
CPK1NP_196107.1 STKc_CAMK 149..407 CDD:270687 101/265 (38%)
PTZ00184 444..586 CDD:185504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.