DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CPK26

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001190949.1 Gene:CPK26 / 829980 AraportID:AT4G38230 Length:514 Species:Arabidopsis thaliana


Alignment Length:275 Identity:96/275 - (34%)
Similarity:147/275 - (53%) Gaps:16/275 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDL 93
            ||:|...|...|.|..||:|:|.|.|.........:      :|..|:||.|:..:.|:..|:.:
plant    60 LGQGQFGTTYMCKEISTGREYACKSITKRKLISKED------VEDVRREIQIMHHLAGYKNIVTI 118

  Fly    94 QDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPEN 158
            :..:|...:|.:|.|||..|||||.:......||:|...:::.|...||..|:..::||||||||
plant   119 KGAYEDPLYVHIVMELCSGGELFDRIIQRGHYSERKAAELIKIIVGVVEACHSLGVMHRDLKPEN 183

  Fly   159 ILL---DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACG 220
            .||   |::.::|..|||.:...:.|:...::.|:|.|:|||.|..:       |..|.|:|..|
plant   184 FLLVNKDDDFSLKAIDFGLSVFFKPGQIFEDVVGSPYYVAPEVLLKH-------YGPEADVWTAG 241

  Fly   221 VIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPSQRITVKEV 285
            ||::.|:.|.||||...|..:...:::|...|.|..|..||:..|:|||..|...||:|:|..:|
plant   242 VILYILVSGVPPFWAETQQGIFDAVLKGHIDFDSDPWPLISDSAKNLIRGMLCSRPSERLTAHQV 306

  Fly   286 LRHPFFNQMVLMGDR 300
            ||||:..:..:..||
plant   307 LRHPWICENGVAPDR 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 94/264 (36%)
S_TKc 23..291 CDD:214567 94/264 (36%)
CPK26NP_001190949.1 Pkinase 54..312 CDD:278497 94/264 (36%)
STKc_CAMK 54..311 CDD:270687 93/263 (35%)
PTZ00184 348..490 CDD:185504
EFh 360..419 CDD:238008
EFh 431..491 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.