DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CIPK8

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_194171.1 Gene:CIPK8 / 828542 AraportID:AT4G24400 Length:445 Species:Arabidopsis thaliana


Alignment Length:272 Identity:96/272 - (35%)
Similarity:144/272 - (52%) Gaps:19/272 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMG 86
            |||....:|.|..:.|:.....|||:..|.||:|.....:.      .|::..::||||::.|. 
plant     8 KYELGRTIGEGTFAKVKFAQNTETGESVAMKIVDRSTIIKR------KMVDQIKREISIMKLVR- 65

  Fly    87 HPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVH 151
            ||.::.|.:|..|...::::.|....|||||.:.....|||.:.|....|:.:||:|.|:|.:.|
plant    66 HPCVVRLYEVLASRTKIYIILEYITGGELFDKIVRNGRLSESEARKYFHQLIDGVDYCHSKGVYH 130

  Fly   152 RDLKPENILLDENHNVKITDFGFAKQLQEGEK-LTNLCGTPGYLAPETLKCNMFEGSPGYSQEV- 214
            |||||||:|||...|:||:|||.:...::|.. |...||||.|:|||.|      ...||:..| 
plant   131 RDLKPENLLLDSQGNLKISDFGLSALPEQGVTILKTTCGTPNYVAPEVL------SHKGYNGAVA 189

  Fly   215 DIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPSQR 279
            |||:||||::.|:.|..||.......:...|  .|..|:.|.:..:.  .|.||.:.|..:|..|
plant   190 DIWSCGVILYVLMAGYLPFDEMDLPTLYSKI--DKAEFSCPSYFALG--AKSLINRILDPNPETR 250

  Fly   280 ITVKEVLRHPFF 291
            ||:.|:.:..:|
plant   251 ITIAEIRKDEWF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 95/270 (35%)
S_TKc 23..291 CDD:214567 94/269 (35%)
CIPK8NP_194171.1 PKc_like 8..261 CDD:419665 95/269 (35%)
CIPK_C 308..423 CDD:213380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.