DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CDPK6

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_194096.1 Gene:CDPK6 / 828465 AraportID:AT4G23650 Length:529 Species:Arabidopsis thaliana


Alignment Length:274 Identity:102/274 - (37%)
Similarity:144/274 - (52%) Gaps:16/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGH 87
            ||....||||..........|||.::.|.|.|.........:      :|..|:|:.|:..:.||
plant    78 YEFGRELGRGQFGVTYLVTHKETKQQVACKSIPTRRLVHKDD------IEDVRREVQIMHHLSGH 136

  Fly    88 PYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHR 152
            ..|:||:..:|....|.|:.|||..|||||.:.|....||:....:.||:...|...|:..::||
plant   137 RNIVDLKGAYEDRHSVNLIMELCEGGELFDRIISKGLYSERAAADLCRQMVMVVHSCHSMGVMHR 201

  Fly   153 DLKPENILL---DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEV 214
            ||||||.|.   |||..:|.||||.:...:.|:|..:|.|:..|:|||.||.|       |..|.
plant   202 DLKPENFLFLSKDENSPLKATDFGLSVFFKPGDKFKDLVGSAYYVAPEVLKRN-------YGPEA 259

  Fly   215 DIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPSQR 279
            |||:.|||::.||.|.||||...:..:...|::|:..|::..|..:|:..|||:||.|..||..|
plant   260 DIWSAGVILYILLSGVPPFWGENETGIFDAILQGQLDFSADPWPALSDGAKDLVRKMLKYDPKDR 324

  Fly   280 ITVKEVLRHPFFNQ 293
            :|..|||.||:..:
plant   325 LTAAEVLNHPWIRE 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 102/270 (38%)
S_TKc 23..291 CDD:214567 102/270 (38%)
CDPK6NP_194096.1 STKc_CAMK 78..335 CDD:270687 101/269 (38%)
PTZ00184 372..515 CDD:185504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.