DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CPK15

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001190794.1 Gene:CPK15 / 828283 AraportID:AT4G21940 Length:561 Species:Arabidopsis thaliana


Alignment Length:265 Identity:95/265 - (35%)
Similarity:143/265 - (53%) Gaps:16/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDL 93
            ||||.......|.|..||..:|.|.|.....|...:      ::..::||.|::.:.|...|:::
plant   108 LGRGQFGITYTCKENSTGNTYACKSILKRKLTRKQD------IDDVKREIQIMQYLSGQENIVEI 166

  Fly    94 QDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPEN 158
            :..:|....:.||.|||...||||.:.:....|||....::|.:...|:..|...::||||||||
plant   167 KGAYEDRQSIHLVMELCGGSELFDRIIAQGHYSEKAAAGVIRSVLNVVQICHFMGVIHRDLKPEN 231

  Fly   159 ILL---DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACG 220
            .||   |||..:|.||||.:..::||:...::.|:..|:|||.|:       ..|.:|:|||:.|
plant   232 FLLASTDENAMLKATDFGLSVFIEEGKVYRDIVGSAYYVAPEVLR-------RSYGKEIDIWSAG 289

  Fly   221 VIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPSQRITVKEV 285
            :|::.||.|.||||...:..:...|::|:..|.|..|..|||..|||:||.|..||.|||:..:.
plant   290 IILYILLCGVPPFWSETEKGIFNEIIKGEIDFDSQPWPSISESAKDLVRKLLTKDPKQRISAAQA 354

  Fly   286 LRHPF 290
            |.||:
plant   355 LEHPW 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 95/265 (36%)
S_TKc 23..291 CDD:214567 95/265 (36%)
CPK15NP_001190794.1 S_TKc 102..360 CDD:214567 95/265 (36%)
STKc_CAMK 102..359 CDD:270687 94/263 (36%)
PTZ00184 395..540 CDD:185504
EFh 407..466 CDD:238008
EFh 478..539 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.