DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CPK23

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001190672.1 Gene:CPK23 / 825809 AraportID:AT4G04740 Length:533 Species:Arabidopsis thaliana


Alignment Length:284 Identity:101/284 - (35%)
Similarity:151/284 - (53%) Gaps:22/284 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PDKDAAKGFYAKYEPKEILGRGISSTVRRCIEKETGKEFAAK-IIDLGATTESGETNPYHMLEAT 74
            |.:|..| ||:....   ||||.......|.|..||..:|.| |:.....:|.|.       |..
plant    61 PFEDIRK-FYSLGRE---LGRGGLGITYMCKEIGTGNIYACKSILKRKLISELGR-------EDV 114

  Fly    75 RQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFE 139
            :.||.|::.:.|.|.:::::..:|....|.||.|||..|||||.:.:....||:.....::.|.:
plant   115 KTEIQIMQHLSGQPNVVEIKGSYEDRHSVHLVMELCAGGELFDRIIAQGHYSERAAAGTIKSIVD 179

  Fly   140 GVEYIHAKSIVHRDLKPENILL---DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKC 201
            .|:..|...::||||||||.|.   :||..:|:||||.:..::||:...::.|:|.|:|||.|: 
plant   180 VVQICHLNGVIHRDLKPENFLFSSKEENAMLKVTDFGLSAFIEEGKIYKDVVGSPYYVAPEVLR- 243

  Fly   202 NMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKD 266
                  ..|.:|:|||:.|||::.||.|.||||...:..:...|::.|..|....|..||:..||
plant   244 ------QSYGKEIDIWSAGVILYILLCGVPPFWADNEEGVFVEILKCKIDFVREPWPSISDSAKD 302

  Fly   267 LIRKCLVVDPSQRITVKEVLRHPF 290
            |:.|.|..||.:|||..:||.||:
plant   303 LVEKMLTEDPKRRITAAQVLEHPW 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 98/276 (36%)
S_TKc 23..291 CDD:214567 96/272 (35%)
CPK23NP_001190672.1 STKc_CAMK 82..326 CDD:270687 91/257 (35%)
S_TKc 84..327 CDD:214567 92/257 (36%)
EF-hand_7 374..433 CDD:290234
EFh 374..433 CDD:238008
EFh 445..>492 CDD:238008
EF-hand_7 446..>492 CDD:290234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.