DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CPK21

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001319867.1 Gene:CPK21 / 825807 AraportID:AT4G04720 Length:531 Species:Arabidopsis thaliana


Alignment Length:291 Identity:110/291 - (37%)
Similarity:159/291 - (54%) Gaps:22/291 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EEDDLL--PDKDAAKGFYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNP 67
            :.|.:|  |.:|..| ||:.  .|| ||||.......|.|..||..:|.|.| |.....|.:.. 
plant    64 DPDTILGKPFEDIRK-FYSL--GKE-LGRGQFGITYMCKEIGTGNTYACKSI-LKRKLISKQDK- 122

  Fly    68 YHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRT 132
                |..::||.|::.:.|.|.|::::..:|....:.||.|||..|||||.:.:....||:....
plant   123 ----EDVKREIQIMQYLSGQPNIVEIKGAYEDRQSIHLVMELCAGGELFDRIIAQGHYSERAAAG 183

  Fly   133 IMRQIFEGVEYIHAKSIVHRDLKPENILL---DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYL 194
            |:|.|...|:..|...:|||||||||.||   :||..:|.||||.:..::||:...::.|:..|:
plant   184 IIRSIVNVVQICHFMGVVHRDLKPENFLLSSKEENAMLKATDFGLSVFIEEGKVYRDIVGSAYYV 248

  Fly   195 APETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWAD 259
            |||.|:       ..|.:|:|||:.|||::.||.|.||||...:..:...:::|:..|.|..|..
plant   249 APEVLR-------RSYGKEIDIWSAGVILYILLSGVPPFWAENEKGIFDEVIKGEIDFVSEPWPS 306

  Fly   260 ISEDPKDLIRKCLVVDPSQRITVKEVLRHPF 290
            |||..|||:||.|..||.:|||..:||.||:
plant   307 ISESAKDLVRKMLTKDPKRRITAAQVLEHPW 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 105/275 (38%)
S_TKc 23..291 CDD:214567 103/271 (38%)
CPK21NP_001319867.1 STKc_CAMK 79..337 CDD:270687 104/273 (38%)
PTZ00184 373..518 CDD:185504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.