DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CPK31

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_680596.2 Gene:CPK31 / 825804 AraportID:AT4G04695 Length:484 Species:Arabidopsis thaliana


Alignment Length:269 Identity:96/269 - (35%)
Similarity:140/269 - (52%) Gaps:20/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDL 93
            ||:|.....|:|:||.:||.:|.|.| |....:|.|..     ||.::||.|::.:.|.|.|::.
plant    34 LGQGQFGITRKCVEKTSGKTYACKTI-LKTNLKSREDE-----EAVKREIRIMKHLSGEPNIVEF 92

  Fly    94 QDVFESDAFVFLVFELCPKGELFDYLTSV----VTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDL 154
            :..:|....|.:|.|.|..||||..:.::    .:.|||:...|:|.|...|:..|...::.|||
plant    93 KKAYEDRDSVHIVMEYCGGGELFKKIEALSKDGKSYSEKEAVEIIRPIVNVVKNCHYMGVMLRDL 157

  Fly   155 KPENILL---DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDI 216
            ||||.||   |:|..||..|||.:..::|||......|:..|:|||.|     :|.  |.:|.||
plant   158 KPENFLLSSTDKNATVKAIDFGCSVFIEEGEVHRKFAGSAYYIAPEVL-----QGK--YGKEADI 215

  Fly   217 WACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPSQRIT 281
            |:.|:|::.||.|.|||....:..|...|...|....|..|..|....|.|:.:.|..:|.:||:
plant   216 WSAGIILYILLCGKPPFVTEPEAQMFSEIKSAKIDVDSESWKFIDVKAKHLVNRMLNRNPKERIS 280

  Fly   282 VKEVLRHPF 290
            ..|||.||:
plant   281 AAEVLGHPW 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 96/269 (36%)
S_TKc 23..291 CDD:214567 96/269 (36%)
CPK31NP_680596.2 STKc_CAMK 27..289 CDD:270687 95/267 (36%)
S_TKc 28..290 CDD:214567 96/269 (36%)
PTZ00184 325..470 CDD:185504
EFh 337..396 CDD:238008
EFh 412..469 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.