DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CPK13

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_190753.2 Gene:CPK13 / 824348 AraportID:AT3G51850 Length:528 Species:Arabidopsis thaliana


Alignment Length:305 Identity:101/305 - (33%)
Similarity:154/305 - (50%) Gaps:35/305 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDDLLPDKDAAKGFYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHM 70
            ||..|.|::              ||||.......|||:.:....|.|.|.......:.:      
plant    51 EDRYLLDRE--------------LGRGEFGVTYLCIERSSRDLLACKSISKRKLRTAVD------ 95

  Fly    71 LEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMR 135
            :|..::|::|::.:.....|:.|::..|.|..|.||.|||..|||||.:.:....:|:....:.:
plant    96 IEDVKREVAIMKHLPKSSSIVTLKEACEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAGVTK 160

  Fly   136 QIFEGVEYIHAKSIVHRDLKPENILL---DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPE 197
            .|.|.|:..|...::||||||||.|.   .||..:|..|||.:...:.|||.:.:.|:|.|:|||
plant   161 TIVEVVQLCHKHGVIHRDLKPENFLFANKKENSPLKAIDFGLSIFFKPGEKFSEIVGSPYYMAPE 225

  Fly   198 TLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISE 262
            .||.|       |..|:|||:.|||::.||.|.||||...:..:.:.|:.|...|....|.:|||
plant   226 VLKRN-------YGPEIDIWSAGVILYILLCGVPPFWAESEQGVAQAILRGVIDFKREPWPNISE 283

  Fly   263 DPKDLIRKCLVVDPSQRITVKEVLRHPFFNQMVLMGDRRHPAPPI 307
            ..|:|:|:.|..||.:|:|.|:||.||:     :...::.|..|:
plant   284 TAKNLVRQMLEPDPKRRLTAKQVLEHPW-----IQNAKKAPNVPL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 95/274 (35%)
S_TKc 23..291 CDD:214567 95/270 (35%)
CPK13NP_190753.2 STKc_CAMK 53..311 CDD:270687 96/284 (34%)
FRQ1 352..493 CDD:227455
EFh_PEF 470..>526 CDD:355382
EF-hand motif 470..497 CDD:320054
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.