DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CRK

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001190048.1 Gene:CRK / 824217 AraportID:AT3G50530 Length:632 Species:Arabidopsis thaliana


Alignment Length:313 Identity:96/313 - (30%)
Similarity:150/313 - (47%) Gaps:51/313 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AKGFYAKYEPKEILGRG-ISSTVRRCIEK--ETGKEFAAKIIDLGATTESGETNPYHMLEATRQE 77
            :|.|.:|||..:.:||| ...|.....:|  ..|::.|.|:|.....|.:      ..:|..|:|
plant   141 SKSFASKYELGDEVGRGHFGYTCAAKFKKGDNKGQQVAVKVIPKAKMTTA------IAIEDVRRE 199

  Fly    78 ISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFD-YLTSVVTLSEKKTRTIMRQIFEGV 141
            :.|||.:.||..:....|.:|....|::|.|||..|||.| .|:.....:|:..:|:|.||...|
plant   200 VKILRALSGHNNLPHFYDAYEDHDNVYIVMELCEGGELLDRILSRGGKYTEEDAKTVMIQILNVV 264

  Fly   142 EYIHAKSIVHRDLKPENILL---DENHNVKITDFGFAKQLQEG---------------------- 181
            .:.|.:.:|||||||||.|.   ::...:|..|||.:..::.|                      
plant   265 AFCHLQGVVHRDLKPENFLFTSKEDTSQLKAIDFGLSDYVRPGKALRLYAICKLRFQNLETSICL 329

  Fly   182 ---------EKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRK 237
                     |:|.::.|:..|:|||.|       ...||.|.|||:.|||::.||.|..|||.|.
plant   330 YALTIAFADERLNDIVGSAYYVAPEVL-------HRSYSTEADIWSVGVIVYILLCGSRPFWART 387

  Fly   238 QMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPSQRITVKEVLRHPF 290
            :..:.|.:::...||..|.|..:|.:.:|.:::.|..||.:|:|..:.|.||:
plant   388 ESGIFRAVLKADPSFDDPPWPLLSSEARDFVKRLLNKDPRKRLTAAQALSHPW 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 95/310 (31%)
S_TKc 23..291 CDD:214567 93/306 (30%)
CRKNP_001190048.1 STKc_CAMK 147..440 CDD:270687 93/305 (30%)
S_TKc 148..441 CDD:214567 93/306 (30%)
Glo_EDI_BRP_like 526..>597 CDD:301325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.