DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and AT3G19100

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_188541.1 Gene:AT3G19100 / 821445 AraportID:AT3G19100 Length:599 Species:Arabidopsis thaliana


Alignment Length:299 Identity:98/299 - (32%)
Similarity:158/299 - (52%) Gaps:26/299 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDEEDDLLPDK--DAAKGFYAKYEPKEILGRG-----ISSTVRRCIEKETGKEFAAKIIDLGATT 60
            ::|.:::..||  ..:|...::.|..|.:|||     .|:..::...|:  :|.|.|:|.....|
plant   122 EEEREEVGLDKRFGFSKELQSRIELGEEIGRGHFGYTCSAKFKKGELKD--QEVAVKVIPKSKMT 184

  Fly    61 ESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFD-YLTSVVT 124
            .:      ..:|..|:|:.|||.:.||..::...|.||.:|.|::|.|||..|||.| .|.....
plant   185 SA------ISIEDVRREVKILRALSGHQNLVQFYDAFEDNANVYIVMELCGGGELLDRILARGGK 243

  Fly   125 LSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILL---DENHNVKITDFGFAKQLQEGEKLTN 186
            .||...:.::.||...|.:.|.:.:|||||||||.|.   :||..:|:.|||.:..::..|:|.:
plant   244 YSEDDAKAVLIQILNVVAFCHLQGVVHRDLKPENFLYTSKEENSMLKVIDFGLSDFVRPDERLND 308

  Fly   187 LCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYS 251
            :.|:..|:|||.|       ...|:.|.|:|:.|||.:.||.|..|||.|.:..:.|.:::...|
plant   309 IVGSAYYVAPEVL-------HRSYTTEADVWSIGVIAYILLCGSRPFWARTESGIFRAVLKADPS 366

  Fly   252 FTSPEWADISEDPKDLIRKCLVVDPSQRITVKEVLRHPF 290
            |..|.|..:|.:.||.:::.|..||.:|:|..:.|.||:
plant   367 FDEPPWPSLSFEAKDFVKRLLYKDPRKRMTASQALMHPW 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 94/281 (33%)
S_TKc 23..291 CDD:214567 94/277 (34%)
AT3G19100NP_188541.1 STKc_CAMK 145..405 CDD:270687 93/274 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.