DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and PPCK2

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_566229.1 Gene:PPCK2 / 819609 AraportID:AT3G04530 Length:278 Species:Arabidopsis thaliana


Alignment Length:269 Identity:87/269 - (32%)
Similarity:143/269 - (53%) Gaps:16/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGH 87
            |:..:.:|||...|:.||....|.:.:|.|.||.....::.:.      |....|..|:..:..|
plant    11 YQLCDEIGRGRFGTITRCFSPATKEFYACKTIDKRVLIDALDR------ECIETEPRIMAMLPPH 69

  Fly    88 PYIIDLQDVFESDAFVFLVFELC-PKGELFDYLTSV-VTLSEKKTRTIMRQIFEGVEYIHAKSIV 150
            |.||.:.|::|::..:.:|.||. |...::|.|.|. ..|||.::.:..:||...:.:.|...:|
plant    70 PNIIRIFDLYETEDSLAIVMELVDPPMTIYDRLISAGGRLSESESASYAKQILSALAHCHRCDVV 134

  Fly   151 HRDLKPENILLD-ENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEV 214
            |||:||:|:|:| .:..||:.|||.|..| .||....:.|||.|:|||.:.      ...|.::|
plant   135 HRDVKPDNVLVDLVSGGVKLCDFGSAVWL-GGETAEGVVGTPYYVAPEVVM------GRKYDEKV 192

  Fly   215 DIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPSQR 279
            |||:.||:::|:|.|.|||.......:..:|:.|...|...::..:|.:.|||:||.:..|.|:|
plant   193 DIWSAGVVIYTMLAGEPPFNGETAEDIFESILRGNLRFPPKKFGSVSSEAKDLLRKMICRDVSRR 257

  Fly   280 ITVKEVLRH 288
            .:.::.|||
plant   258 FSAEDALRH 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 87/269 (32%)
S_TKc 23..291 CDD:214567 87/269 (32%)
PPCK2NP_566229.1 STKc_CAMK 10..268 CDD:270687 87/269 (32%)
S_TKc 11..269 CDD:214567 87/269 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.