DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CRK3

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_182193.1 Gene:CRK3 / 819282 AraportID:AT2G46700 Length:595 Species:Arabidopsis thaliana


Alignment Length:285 Identity:93/285 - (32%)
Similarity:142/285 - (49%) Gaps:28/285 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KGFYAKYEPKEILGRGISSTVRRCIEKETGKE-------FAAKIIDLGATTESGETNPYHMLEAT 74
            |.|.||||..:.:|||...  ..|..:  ||:       .|.|||.....|.:      ..:|..
plant   137 KNFGAKYELGKEVGRGHFG--HTCSGR--GKKGDIKDHPIAVKIISKAKMTTA------IAIEDV 191

  Fly    75 RQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFD-YLTSVVTLSEKKTRTIMRQIF 138
            |:|:.:|:.:.||.|:|...|..|....|::|.|||..|||.| .|.......|...:.|:.||.
plant   192 RREVKLLKSLSGHKYLIKYYDACEDANNVYIVMELCDGGELLDRILARGGKYPEDDAKAIVVQIL 256

  Fly   139 EGVEYIHAKSIVHRDLKPENILLD---ENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLK 200
            ..|.:.|.:.:|||||||||.|..   |:.::|:.|||.:..::..|:|.::.|:..|:|||.| 
plant   257 TVVSFCHLQGVVHRDLKPENFLFTSSREDSDLKLIDFGLSDFIRPDERLNDIVGSAYYVAPEVL- 320

  Fly   201 CNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPK 265
                  ...||.|.|||:.|||.:.||.|..|||.|.:..:.|.::..:.::....|...|.:.|
plant   321 ------HRSYSLEADIWSIGVITYILLCGSRPFWARTESGIFRTVLRTEPNYDDVPWPSCSSEGK 379

  Fly   266 DLIRKCLVVDPSQRITVKEVLRHPF 290
            |.:::.|..|..:|::..:.|.||:
plant   380 DFVKRLLNKDYRKRMSAVQALTHPW 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 92/283 (33%)
S_TKc 23..291 CDD:214567 89/279 (32%)
CRK3NP_182193.1 STKc_CAMK 142..404 CDD:270687 89/278 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.