DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CPK20

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_181425.1 Gene:CPK20 / 818476 AraportID:AT2G38910 Length:583 Species:Arabidopsis thaliana


Alignment Length:265 Identity:101/265 - (38%)
Similarity:147/265 - (55%) Gaps:16/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDL 93
            ||:|...|...|::|:||||||.|.|.....|...:      :|..|:||.|:..:.|||.:|.:
plant   140 LGQGQFGTTFLCVDKKTGKEFACKTIAKRKLTTPED------VEDVRREIQIMHHLSGHPNVIQI 198

  Fly    94 QDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPEN 158
            ...:|....|.:|.|:|..|||||.:......:|||...:.|.|...:|..|:..::||||||||
plant   199 VGAYEDAVAVHVVMEICAGGELFDRIIQRGHYTEKKAAELARIIVGVIEACHSLGVMHRDLKPEN 263

  Fly   159 ILL---DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACG 220
            .|.   ||...:|..|||.:...:.||..|::.|:|.|:|||.|:.:       ||.|.|:|:.|
plant   264 FLFVSGDEEAALKTIDFGLSVFFKPGETFTDVVGSPYYVAPEVLRKH-------YSHECDVWSAG 321

  Fly   221 VIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPSQRITVKEV 285
            ||::.||.|.||||...:..:...:::|...|.|..|..:||..|||:|:.|:.||.:|:|..||
plant   322 VIIYILLSGVPPFWDETEQGIFEQVLKGDLDFISEPWPSVSESAKDLVRRMLIRDPKKRMTTHEV 386

  Fly   286 LRHPF 290
            |.||:
plant   387 LCHPW 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 101/265 (38%)
S_TKc 23..291 CDD:214567 101/265 (38%)
CPK20NP_181425.1 STKc_CAMK 134..391 CDD:270687 100/263 (38%)
FRQ1 432..572 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.