DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CPK16

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_179379.1 Gene:CPK16 / 816299 AraportID:AT2G17890 Length:571 Species:Arabidopsis thaliana


Alignment Length:283 Identity:91/283 - (32%)
Similarity:146/283 - (51%) Gaps:18/283 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AKGFYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISI 80
            ||.|..:|...::||.|.........:|:||...|.|.||     ::..|.|. .:|..::|:.|
plant   101 AKDFDHRYTIGKLLGHGQFGYTYVATDKKTGDRVAVKKID-----KAKMTIPI-AVEDVKREVKI 159

  Fly    81 LRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTS--VVTLSEKKTRTIMRQIFEGVEY 143
            |:.:.||..::...:.||....|::|.|||..|||.|.:.:  ....||:....::||:.:....
plant   160 LQALTGHENVVRFYNAFEDKNSVYIVMELCEGGELLDRILARKDSRYSERDAAVVVRQMLKVAAE 224

  Fly   144 IHAKSIVHRDLKPENILL---DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFE 205
            .|.:.:||||:||||.|.   :|:..:|.||||.:..::.|:|..::.|:..|:|||.||...  
plant   225 CHLRGLVHRDMKPENFLFKSTEEDSPLKATDFGLSDFIKPGKKFHDIVGSAYYVAPEVLKRRS-- 287

  Fly   206 GSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRK 270
                 ..|.|:|:.|||.:.||.|..|||.:.:..:.:.:::.|..|....|..||...||.::|
plant   288 -----GPESDVWSIGVISYILLCGRRPFWDKTEDGIFKEVLKNKPDFRRKPWPTISNSAKDFVKK 347

  Fly   271 CLVVDPSQRITVKEVLRHPFFNQ 293
            .||.||..|:|..:.|.||:..:
plant   348 LLVKDPRARLTAAQALSHPWVRE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 89/276 (32%)
S_TKc 23..291 CDD:214567 88/272 (32%)
CPK16NP_179379.1 STKc_CAMK 107..367 CDD:270687 87/272 (32%)
S_TKc 108..368 CDD:214567 88/272 (32%)
PTZ00184 404..549 CDD:185504
EFh 415..476 CDD:238008
EFh 496..550 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.