DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CAMK2B

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_011513849.1 Gene:CAMK2B / 816 HGNCID:1461 Length:709 Species:Homo sapiens


Alignment Length:389 Identity:129/389 - (33%)
Similarity:195/389 - (50%) Gaps:39/389 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQ 83
            |..:|:..|.:|:|..|.||||::..||.|:|||||:    |:......:..||   :|..|.| 
Human    10 FTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIIN----TKKLSARDHQKLE---REARICR- 66

  Fly    84 VMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKS 148
            ::.|..|:.|.|....:.|.:|||:|...||||:.:.:....||......::||.|.|.:.|...
Human    67 LLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMG 131

  Fly   149 IVHRDLKPENILLD---ENHNVKITDFGFAKQLQ-EGEKLTNLCGTPGYLAPETLKCNMFEGSPG 209
            :|||||||||:||.   :...||:.|||.|.::| :.:......||||||:||.|:      ...
Human   132 VVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLR------KEA 190

  Fly   210 YSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVV 274
            |.:.|||||||||::.||||.||||...|..:.:.|..|.|.|.||||..::.:.|:||.:.|.:
Human   191 YGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTI 255

  Fly   275 DPSQRITVKEVLRHPFFNQMVLMGDRRHPAPPI-APAQTNSRHLLQPEASSYRFGQLNSSCAGAP 338
            :|::|||..|.|:||:..|...:....|....: ...:.|:|..|:        |.:.::.....
Human   256 NPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLK--------GAILTTMLATR 312

  Fly   339 NYLYCAPQSSYSSNRMRDGALDDAGASAASATCHVMSPSNASNSYATNT---TANTSNSALASA 399
            |         :|..|........:.|::.:....|....:..|..|...   |.:|.|||.|::
Human   313 N---------FSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATS 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 110/275 (40%)
S_TKc 23..291 CDD:214567 109/271 (40%)
CAMK2BXP_011513849.1 STKc_CaMKII 12..303 CDD:270988 114/312 (37%)
S_TKc 14..272 CDD:214567 109/271 (40%)
CaMKII_AD 577..704 CDD:285524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.