DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and camk2b

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_009303979.1 Gene:camk2b / 798222 -ID:- Length:537 Species:Danio rerio


Alignment Length:391 Identity:129/391 - (32%)
Similarity:202/391 - (51%) Gaps:28/391 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQ 83
            |..:|:..|.||:|..|.||||.:..||:|:|:|||:    |:......:..||   :|..|.| 
Zfish     9 FTDEYQLYEELGKGAFSVVRRCAKLSTGQEYASKIIN----TKKLSARDHQKLE---REARICR- 65

  Fly    84 VMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKS 148
            ::.|..|:.|.|....:.|.:|:|:|...||||:.:.:....||......::||.|.|.:.|...
Zfish    66 LLKHSNIVRLHDSISEEGFHYLLFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMG 130

  Fly   149 IVHRDLKPENILLD---ENHNVKITDFGFAKQLQ-EGEKLTNLCGTPGYLAPETLKCNMFEGSPG 209
            :|||||||||:||.   :|..||:.|||.|.::| :.:......||||||:||.|:      ...
Zfish   131 VVHRDLKPENLLLASKCKNAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLR------KEA 189

  Fly   210 YSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVV 274
            |.:.|||||||||::.||||.||||...|..:.:.|..|.|.|.||||..::.:.|:||.:.|.:
Zfish   190 YGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTI 254

  Fly   275 DPSQRITVKEVLRHPFFNQMVLMGDRRHPAPPI-APAQTNSRHLLQPEASSYRFGQLNSSCAGAP 338
            :|.:|||.:|.|:||:..|...:....|....: ...:.|:|..|:        |.:.::...:.
Zfish   255 NPVKRITAQEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLK--------GAILTTMLVSR 311

  Fly   339 NYLYCAPQSSYSSNRMRDGALDDAGASAASATCHVMSPSNASNSYATNTTANTSNSALASASSHK 403
            |:......::.|:.....|.::.|..|..:....| .|.:.|||..:::.::...|....|...:
Zfish   312 NFSVGRQTTAPSTISAATGLVEQAAKSLLNKKTEV-KPQSQSNSVKSSSVSSPKGSVPPPALEPQ 375

  Fly   404 T 404
            |
Zfish   376 T 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 110/275 (40%)
S_TKc 23..291 CDD:214567 109/271 (40%)
camk2bXP_009303979.1 STKc_CaMKII 11..302 CDD:270988 114/312 (37%)
S_TKc 13..271 CDD:214567 109/271 (40%)
CaMKII_AD 405..532 CDD:285524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.