DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and pnck

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_021334045.1 Gene:pnck / 567480 ZFINID:ZDB-GENE-081105-127 Length:333 Species:Danio rerio


Alignment Length:287 Identity:104/287 - (36%)
Similarity:157/287 - (54%) Gaps:19/287 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLPDKDAAKGFYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEA 73
            ||.|........|.||.||.||.|..|.||....:.|.|..|.|.|...|.  .|:.:   ||| 
Zfish     3 LLRDLRKKDDINAVYELKEKLGEGSFSEVRVAQHRCTQKLVAVKCIRKRAL--KGKES---MLE- 61

  Fly    74 TRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIF 138
              .|:::||:: .|..|:.|::.||:...::||..|...|||.:.:....:.:||....::.|:.
Zfish    62 --NEVAVLRRI-NHENIVSLEETFETPTKLYLVMTLLTGGELLNRILERGSYTEKDASRVIYQVL 123

  Fly   139 EGVEYIHAKSIVHRDLKPENILLD---ENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLK 200
            :.|:|:|...:|||||||||::.:   |:..:.|:|||.:|..::| .|:..||||.|:|||.|:
Zfish   124 QAVKYLHQLGVVHRDLKPENLIFETPLEDSKIVISDFGLSKMEEQG-ALSTACGTPAYVAPELLQ 187

  Fly   201 CNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPK 265
                  ...|.:|||:||.|||.|.||.|.|||:......:.:.|::.:|.|.||.|.|||:..|
Zfish   188 ------QKTYGKEVDLWAIGVITFILLCGYPPFYDDNDTQLYKLIIKAEYEFDSPYWNDISDSAK 246

  Fly   266 DLIRKCLVVDPSQRITVKEVLRHPFFN 292
            |.|...|..||::|...::..:||:.:
Zfish   247 DFIVHLLQKDPAKRFNCEQASQHPWIS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 101/274 (37%)
S_TKc 23..291 CDD:214567 100/270 (37%)
pnckXP_021334045.1 PKc_like 13..289 CDD:328722 101/277 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.