DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and camkva

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_009300900.1 Gene:camkva / 567243 ZFINID:ZDB-GENE-100819-2 Length:386 Species:Danio rerio


Alignment Length:290 Identity:103/290 - (35%)
Similarity:147/290 - (50%) Gaps:41/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PKEI-----LGRGISS----TVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISI 80
            |.|:     ||:.:.|    .:.|..:|.|.|.:..|..    ..:.|.    .:.:|.:.||.|
Zfish    17 PSEVTDKYDLGQVVKSEEFCEIFRAKDKNTLKMYTCKKF----LKKDGR----KVRKAAKNEILI 73

  Fly    81 LRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIH 145
            |:.|. |..|:.|.||||:....||..||....|:||::......||:.|..::||:.|.|.|:|
Zfish    74 LKMVK-HHNILQLVDVFETRKEYFLFLELATGREVFDWILDQGYYSERDTSNVIRQVLEAVAYLH 137

  Fly   146 AKSIVHRDLKPENILLD---ENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGS 207
            :..||||:||.||::..   :|..:.|:||..|| |:.| .:...||||.|||||.:      |.
Zfish   138 SLRIVHRNLKLENLVYYNRLKNSKIVISDFHLAK-LENG-LIKEPCGTPEYLAPEVV------GR 194

  Fly   208 PGYSQEVDIWACGVIMFTLLVGCPPFW----------HRKQMVMLRNIMEGKYSFTSPEWADISE 262
            ..|.:.||.||.||||:.||.|.|||:          |.|.  :.|.|:.|.|.|.||.|.|||:
Zfish   195 QRYGRPVDCWAIGVIMYILLSGNPPFYDETDDDDYDNHDKN--LFRKILSGDYEFDSPYWDDISD 257

  Fly   263 DPKDLIRKCLVVDPSQRITVKEVLRHPFFN 292
            ..|.|:...:.||..||:|.:|.:.|.:.:
Zfish   258 SAKSLVACLMDVDQDQRLTAQEAINHEWIS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 103/287 (36%)
S_TKc 23..291 CDD:214567 103/287 (36%)
camkvaXP_009300900.1 PKc_like 22..286 CDD:304357 101/282 (36%)
S_TKc 24..286 CDD:214567 101/280 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.