DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and mylk3

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001099057.1 Gene:mylk3 / 561635 ZFINID:ZDB-GENE-030131-3497 Length:715 Species:Danio rerio


Alignment Length:278 Identity:95/278 - (34%)
Similarity:138/278 - (49%) Gaps:19/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQV 84
            |....|.|:||.|....|.:|.|..:|...|||||.:....|..|         .:.||.::.| 
Zfish   401 YYAVNPVEVLGGGRFGQVHKCAELSSGLTLAAKIIKVRGMKERDE---------VKNEIGVMNQ- 455

  Fly    85 MGHPYIIDLQDVFESDAFVFLVFELCPKGELFD-YLTSVVTLSEKKTRTIMRQIFEGVEYIHAKS 148
            :.|..:|.|.|.|||...:.|:.|....||||: .:.....|:|.......|||.|||:|:|.:.
Zfish   456 LNHVNLIQLYDAFESRTNLTLIMEYVEGGELFERIIDESYQLTELDAIVFTRQICEGVQYLHQQY 520

  Fly   149 IVHRDLKPENILL--DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYS 211
            |:|.||||||||.  ...:.:||.|||.|::.:..|||....|||.:||||.:..: |...|   
Zfish   521 ILHLDLKPENILCVNSTGNQIKIIDFGLARKYRPREKLKVNFGTPEFLAPEVVNYD-FVSFP--- 581

  Fly   212 QEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDP 276
              .|:|:.|||.:.||.|..||........:.||:..|:.|.:..:.::||:.||.|...||...
Zfish   582 --TDMWSVGVITYMLLSGLSPFMGDNDAETMNNILHAKWEFDTEAFENVSEEAKDFISSLLVSAK 644

  Fly   277 SQRITVKEVLRHPFFNQM 294
            ..|::....::|.:.|.:
Zfish   645 CSRLSASGCMKHSWLNNL 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 94/273 (34%)
S_TKc 23..291 CDD:214567 93/270 (34%)
mylk3NP_001099057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..114
STKc_MLCK3 399..659 CDD:271094 94/273 (34%)
S_TKc 407..659 CDD:214567 92/267 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4277
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.