DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and camk1a

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_021332939.1 Gene:camk1a / 555945 ZFINID:ZDB-GENE-131120-147 Length:394 Species:Danio rerio


Alignment Length:273 Identity:105/273 - (38%)
Similarity:154/273 - (56%) Gaps:18/273 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGH 87
            |:.||:||.|..|.|....||:|.:..|.|.|...|.  .|:.|      :...||::|.::. |
Zfish    21 YDFKEVLGTGAFSEVFLAEEKKTQRLVAIKCIPKKAL--EGKEN------SIENEIAVLHRIK-H 76

  Fly    88 PYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHR 152
            ..|:.|:|:|||.:.::||.:|...|||||.:......:|:....::|||.:.|:|:|...||||
Zfish    77 ENIVSLEDIFESQSHLYLVMQLVSGGELFDRIVEKGFYTERDASKLIRQILDAVKYLHDMGIVHR 141

  Fly   153 DLKPENIL---LDENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEV 214
            ||||||:|   ::|:.|:.|:|||.:|....|..::..||||||:|||.|      ....||:.|
Zfish   142 DLKPENLLYYSMEEDSNIMISDFGLSKIEDSGSVMSTACGTPGYVAPEVL------AQKPYSKAV 200

  Fly   215 DIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPSQR 279
            |.|:.|||.:.||.|.|||:......:...|::.:|.|.||.|.|||:..||.|...:..|||.|
Zfish   201 DCWSIGVISYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFISHLMEKDPSLR 265

  Fly   280 ITVKEVLRHPFFN 292
            .|.::.|.||:.:
Zfish   266 YTCEQALLHPWIS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 105/270 (39%)
S_TKc 23..291 CDD:214567 105/270 (39%)
camk1aXP_021332939.1 STKc_CaMKI 17..276 CDD:270985 104/269 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.