DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and Camk1

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_598687.1 Gene:Camk1 / 52163 MGIID:1098535 Length:374 Species:Mus musculus


Alignment Length:280 Identity:104/280 - (37%)
Similarity:153/280 - (54%) Gaps:23/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGH 87
            |:.:::||.|..|.|....:|.|.|..|.|.|...| .|..|       .:...||::|.::. |
Mouse    20 YDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKA-LEGKE-------GSMENEIAVLHKIK-H 75

  Fly    88 PYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHR 152
            |.|:.|.|::||...::|:.:|...|||||.:......:|:....::.|:.:.|:|:|...||||
Mouse    76 PNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHR 140

  Fly   153 DLKPENIL---LDENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEV 214
            ||||||:|   |||:..:.|:|||.:|....|..|:..||||||:|||.|      ....||:.|
Mouse   141 DLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVL------AQKPYSKAV 199

  Fly   215 DIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPSQR 279
            |.|:.|||.:.||.|.|||:......:...|::.:|.|.||.|.|||:..||.||..:..||.:|
Mouse   200 DCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKR 264

  Fly   280 ITVKEVLRHPFFNQMVLMGD 299
            .|.::.|:||:     :.||
Mouse   265 FTCEQALQHPW-----IAGD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 102/270 (38%)
S_TKc 23..291 CDD:214567 102/270 (38%)
Camk1NP_598687.1 STKc_CaMKI_alpha 16..278 CDD:271069 102/277 (37%)
Autoinhibitory domain. /evidence=ECO:0000250 276..316 2/4 (50%)
Calmodulin-binding. /evidence=ECO:0000250 296..317
Nuclear export signal. /evidence=ECO:0000250 315..321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.