DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and camk1gb

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_021325441.1 Gene:camk1gb / 393802 ZFINID:ZDB-GENE-040426-1694 Length:486 Species:Danio rerio


Alignment Length:267 Identity:103/267 - (38%)
Similarity:148/267 - (55%) Gaps:21/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYII 91
            ::||.|..|.|....|::|||.||.|.:......:....|          ||::||::. |..::
Zfish    78 DVLGSGAFSEVFMVKERKTGKLFAMKCVKKKNKRDINLEN----------EIAVLRKIK-HENVV 131

  Fly    92 DLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKP 156
            .|:|.:||....:||.:|...|||||.:......||....:::||:.|.|.|:|...||||||||
Zfish   132 CLEDFYESRTHYYLVMQLVSGGELFDRILDRGMYSEMDASSVIRQVLEAVSYLHNNGIVHRDLKP 196

  Fly   157 ENILL---DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDIWA 218
            ||:|.   |||..:.|:|||.:| :::...::..||||||:|||.|      ....||:.||.|:
Zfish   197 ENLLYYSPDENSKIMISDFGLSK-MEDNGVMSTACGTPGYVAPEVL------AQKPYSKAVDCWS 254

  Fly   219 CGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPSQRITVK 283
            .|||.:.||.|.|||:...:..:...||:|:|.|.||.|.||||..||.||..:..:|..|...:
Zfish   255 IGVITYILLCGYPPFYEETETRLFSKIMKGQYEFDSPFWDDISESAKDFIRNMMQKNPKMRFNTE 319

  Fly   284 EVLRHPF 290
            :.||||:
Zfish   320 QALRHPW 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 103/267 (39%)
S_TKc 23..291 CDD:214567 103/267 (39%)
camk1gbXP_021325441.1 PKc_like 70..353 CDD:328722 103/267 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.