DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and Camk1d

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001100835.1 Gene:Camk1d / 307124 RGDID:1560691 Length:385 Species:Rattus norvegicus


Alignment Length:423 Identity:136/423 - (32%)
Similarity:194/423 - (45%) Gaps:69/423 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKDEEDDLLPDKDAAKGFYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGAT--TESG 63
            ||::..:.....|..|:.....:|.||.||.|..|.|....||.|||.||.|.|...|.  .||.
  Rat     1 MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESS 65

  Fly    64 ETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEK 128
            ..|          ||::||::. |..|:.|:|::||...::||.:|...|||||.:......:||
  Rat    66 IEN----------EIAVLRKIK-HENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEK 119

  Fly   129 KTRTIMRQIFEGVEYIHAKSIVHRDLKPENILL---DENHNVKITDFGFAKQLQEGEKLTNLCGT 190
            ...|::||:.:.|.|:|...||||||||||:|.   ||...:.|:|||.:|...:|:.::..|||
  Rat   120 DASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGT 184

  Fly   191 PGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSP 255
            |||:|||.|      ....||:.||.|:.|||.:.||.|.|||:......:...|::.:|.|.||
  Rat   185 PGYVAPEVL------AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSP 243

  Fly   256 EWADISEDPKDLIRKCLVVDPSQRITVKEVLRHPFFNQMVLMGDRRHPAPPIAPAQTNS------ 314
            .|.|||:..||.||..:..||::|.|.::..|||:......:....|.:   ..||...      
  Rat   244 YWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALSKNIHES---VSAQIRKNFAKSK 305

  Fly   315 -----------RHLLQPEASSYRFGQLNSSCAGAPNYLYCAPQSSYSSNRMRDGALDDAGASAAS 368
                       ||:.:.:..|    .|:||.|...:.|..|.|..               ..|.|
  Rat   306 WRQAFNATAVVRHMRRLQLGS----SLDSSNASVSSNLSLASQKD---------------CLAPS 351

  Fly   369 ATCHVMSPSNASNSY--------ATNTTANTSN 393
            ..|..:|.|:.....        .|.||.:|.:
  Rat   352 TLCSFLSSSSGVAGVGAERRPRPTTVTTGHTGS 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 110/276 (40%)
S_TKc 23..291 CDD:214567 110/272 (40%)
Camk1dNP_001100835.1 STKc_CaMKI_delta 12..312 CDD:271070 115/319 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.