DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and Dclk3

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_766516.2 Gene:Dclk3 / 245038 MGIID:3039580 Length:790 Species:Mus musculus


Alignment Length:278 Identity:100/278 - (35%)
Similarity:158/278 - (56%) Gaps:23/278 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGH 87
            |:...::|.|..:||:.|..:||.:.:|.|:||  .:...|:.      :....||.|: |.:.|
Mouse   514 YDIGGVIGDGNFATVKECRHRETKQAYAMKMID--KSQLKGKE------DIVDSEILII-QSLSH 569

  Fly    88 PYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHR 152
            |.|:.|.:|:|::|.::|:.|....|:|||.:...|...|.:...::..:.:.:.::|.|:||||
Mouse   570 PNIVKLHEVYETEAEIYLIMEYVQGGDLFDAIVENVKFPEPEAAVMITDLCKALVHMHDKNIVHR 634

  Fly   153 DLKPENILLDENHN----VKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQE 213
            |:||||:|:..|.:    :|:.|||.||.:.  ..:..:||||.|:|||.|      ...||..|
Mouse   635 DVKPENLLVQRNEDKSITLKLADFGLAKYVV--RPIFTVCGTPTYVAPEIL------SEKGYGLE 691

  Fly   214 VDIWACGVIMFTLLVGCPPFW--HRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDP 276
            ||:||.|||::.||.|.|||.  .|.|..:...|..|::.|.||.|.:||:..|||:|..|.|||
Mouse   692 VDMWAAGVILYILLCGFPPFRSPERDQDELFNIIQVGQFEFLSPYWDNISDAAKDLVRNLLEVDP 756

  Fly   277 SQRITVKEVLRHPFFNQM 294
            .:|.|.::||:||:...:
Mouse   757 KKRYTAEQVLQHPWIEMV 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 100/273 (37%)
S_TKc 23..291 CDD:214567 100/273 (37%)
Dclk3NP_766516.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
UBQ 92..177 CDD:294102
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..290
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..506
PKc_like 513..770 CDD:304357 99/272 (36%)
S_TKc 514..771 CDD:214567 100/273 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.