DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and Pskh1

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_775608.1 Gene:Pskh1 / 244631 MGIID:3528383 Length:424 Species:Mus musculus


Alignment Length:340 Identity:113/340 - (33%)
Similarity:166/340 - (48%) Gaps:36/340 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVM 85
            |||:.|.::|||..|.|.|...:.|.:.:|.|:|         ||......|....|:.:||:|.
Mouse    96 AKYDIKALIGRGSFSRVVRVEHRATRQPYAIKMI---------ETKYREGREVCESELRVLRRVR 151

  Fly    86 GHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIV 150
             |..||.|.:|||:...|::|.||...|||||.:.:..:.:|:....:::.:.:||.|:||..|.
Mouse   152 -HANIIQLVEVFETQERVYMVMELATGGELFDRIIAKGSFTERDATRVLQMVLDGVRYLHALGIT 215

  Fly   151 HRDLKPENILL---DENHNVKITDFGFAKQLQEGEK--LTNLCGTPGYLAPETLKCNMFEGSPGY 210
            ||||||||:|.   ..:..:.|||||.|...::|:.  :...||||.|:|||.|.      ...|
Mouse   216 HRDLKPENLLYYHPGTDSKIIITDFGLASARKKGDDCLMKTTCGTPEYIAPEVLV------RKPY 274

  Fly   211 SQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVD 275
            :..||:||.|||.:.||.|..||....:..:.|.|:.||||:....|..:|...||.|.:.|.||
Mouse   275 TNSVDMWALGVIAYILLSGTMPFEDDNRTRLYRQILRGKYSYLGEPWPSVSNLAKDFIDRLLTVD 339

  Fly   276 PSQRITVKEVLRHPFFNQMVLMGDRRHPAPPIAPAQTNSRHLLQPEASSYRFGQLNSSCAGAPNY 340
            |..|:|..:.||||:.               ::.|.::|...|....|.....:.:|.|....:.
Mouse   340 PGARMTALQALRHPWV---------------VSMAASSSMKNLHRSISQNLLKRASSRCQSTKSS 389

  Fly   341 LYCAPQSSYSSNRMR 355
            .......|..||:.|
Mouse   390 QSTRSSRSTRSNKSR 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 103/274 (38%)
S_TKc 23..291 CDD:214567 101/272 (37%)
Pskh1NP_775608.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..79
STKc_PSKH1 96..355 CDD:270989 103/274 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..408 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.