DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and dclk2

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_012811056.1 Gene:dclk2 / 100487296 XenbaseID:XB-GENE-960488 Length:727 Species:Xenopus tropicalis


Alignment Length:284 Identity:107/284 - (37%)
Similarity:164/284 - (57%) Gaps:23/284 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMG 86
            ||:..:::|.|..:.|:.|:|:.||||||.||||     ::......|::|   .|:||||||. 
 Frog   397 KYKIGKVIGDGNFAVVKECVERSTGKEFALKIID-----KAKCCGKEHLIE---NEVSILRQVK- 452

  Fly    87 HPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVH 151
            ||.||.|.:..::.|.::||.||...|:|||.:||....:|:....::..:...::|:|...|||
 Frog   453 HPNIIMLIEEMDTTAELYLVMELVKGGDLFDAITSSTKYTERDASAMVYNLASAMKYLHGLHIVH 517

  Fly   152 RDLKPENILL----DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQ 212
            ||:||||:|:    |:..::|:.|||.| .:.:| .|..:||||.|:|||.:      ...||..
 Frog   518 RDIKPENLLVCEYPDKTKSLKLGDFGLA-TVVDG-PLYTVCGTPTYVAPEII------AETGYGL 574

  Fly   213 EVDIWACGVIMFTLLVGCPPF--WHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVD 275
            :|||||.|||.:.||.|.|||  .:..|..:...|:.||..|.||.|.:|::..|:||...|.|:
 Frog   575 KVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILIGKLEFPSPYWDNITDSAKELISCMLQVN 639

  Fly   276 PSQRITVKEVLRHPFFNQMVLMGD 299
            ..:|.|.:::|.||:.:.....|:
 Frog   640 VEERYTAEQILSHPWVSDDASQGN 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 106/274 (39%)
S_TKc 23..291 CDD:214567 105/273 (38%)
dclk2XP_012811056.1 DCX1_DCLK2 70..154 CDD:340661
DCX2 193..276 CDD:340589
STKc_DCKL2 396..654 CDD:271086 105/273 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.