DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB2 and Ubx

DIOPT Version :9

Sequence 1:NP_002136.1 Gene:HOXB2 / 3212 HGNCID:5113 Length:356 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:166 Identity:59/166 - (35%)
Similarity:77/166 - (46%) Gaps:44/166 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    95 FPWM------KEKKSAKKPSQSAT-------------SPSPAASAVPASGVGSPADGLGLPEAGG 140
            :|||      .|..:..|.....|             |.|.|.|.:|        |.||.    .
  Fly   240 YPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLP--------DWLGT----N 292

Human   141 GGARRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQHR 205
            |..||.|..||..|.||||||||.|.||.|.||:|:|..|.|||||:|:||||||||.|::.|  
  Fly   293 GLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQ-- 355

Human   206 EPPDGEPACPGALEDICDPAEEPAASPGGPSASRAA 241
                       |::::.:..::..|.....:|:.||
  Fly   356 -----------AIKELNEQEKQAQAQKAAAAAAAAA 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB2NP_002136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..142 14/65 (22%)
Antp-type hexapeptide 94..99 3/9 (33%)
Homeobox 147..199 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..240 6/42 (14%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.