DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bif and si:dkey-12h9.6

DIOPT Version :9

Sequence 1:NP_001259457.1 Gene:bif / 32119 FlyBaseID:FBgn0014133 Length:1305 Species:Drosophila melanogaster
Sequence 2:XP_005160659.1 Gene:si:dkey-12h9.6 / 569780 ZFINID:ZDB-GENE-041001-145 Length:638 Species:Danio rerio


Alignment Length:449 Identity:79/449 - (17%)
Similarity:151/449 - (33%) Gaps:144/449 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RPSLDLHTDVPAGLAAGGS-GLGAAAEMSPTSGFLPDMPQWKKDLIQRRKTNVARTQAASITSPT 69
            ||..||:...||....||. .|.:.:.:..|.. ||...|..|.| :..|:::.:.|.:|:..|.
Zfish   254 RPEKDLNPQTPASKHRGGEIHLDSTSILEMTEN-LPQDDQSSKAL-RSSKSSLPKVQRSSVNVPN 316

  Fly    70 DGSCGALAEANAAPGAIADFTEPATISSTSQKRNMIGSEEKSEKS--SISNTNSDSTGGHHSVVA 132
                                                |..||.:|:  :|::|..           
Zfish   317 ------------------------------------GKAEKRQKNLKAINSTGE----------- 334

  Fly   133 VSLSPDAAATTNVTVTPIPKQRSSLLNTRSQEREMVRYILSESGERDGELESGEQPAGVVSNSRC 197
               |.:..::...|..|.|       |..:...|.:..:..|..:..|||::..|....:.:..|
Zfish   335 ---SVERCSSNIPTHNPPP-------NPSNPHAEQMLKLEQELRKLKGELQASRQSEQELRSHIC 389

  Fly   198 GEVETGTIGSPSSSANQNPNPNHLKTKCKPGQSVAEGKPSAKETIVDNSKSCS----KTKSISD- 257
            ....:.....|..|..::.| ..|:.|.   |.:::.:...|:       :||    |.:..:| 
Zfish   390 NLTNSEHSLRPEVSLLRHAN-ELLQNKI---QCLSKSRQKDKQ-------NCSLLEKKIRMETDA 443

  Fly   258 ---------KLQSNKF-----IIQQQQQQQQQQQQQ-------------QQLSPTKVTVKPTMVA 295
                     ::::.||     :::....:|:|.:.|             :||.......:..|:|
Zfish   444 RVVVEKQLTEVRAQKFDEATILLRSASHRQEQSETQMLRKKAKDLDSEYKQLQLEYQGKENRMIA 508

  Fly   296 MQ---EMKKTTKQNGQHRH-----LAGKIGSVAGGDVDPQHPPTNPIPDSLDTGEDLSYGPGIVS 352
            ::   |:|..|.|..:...     |...:.|:.                  |..:.|.|.....:
Zfish   509 LENEVEVKDATLQRNRCSEQEADALLSALSSLQ------------------DKAQHLEYNLSAET 555

  Fly   353 KLRCRYLSLALRESRQQSSKQRLQRSTSLNTLLDRDDDEVEVEEPEMTNSQVRAKSTPP 411
            :|:....| ||.::|:|....:::        :.:.|.||:    ||......|.:..|
Zfish   556 RLKLDLFS-ALGDARRQLEIAQVK--------ILKQDHEVK----EMKQKLAEAMAVAP 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bifNP_001259457.1 None
si:dkey-12h9.6XP_005160659.1 Macoilin 2..636 CDD:313022 79/449 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13289
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.