DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vlet and commd10

DIOPT Version :9

Sequence 1:NP_572738.1 Gene:Vlet / 32116 FlyBaseID:FBgn0030323 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_031757047.1 Gene:commd10 / 733903 XenbaseID:XB-GENE-941185 Length:257 Species:Xenopus tropicalis


Alignment Length:208 Identity:43/208 - (20%)
Similarity:88/208 - (42%) Gaps:42/208 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 INW----------IKITERAREGIKIINALPYETFTTVLFYTHRQMSPSVASASATSSTVGTSVT 57
            :||          :|.|...:..:.|||::....|..:|                  |.:...:.
 Frog    57 LNWNRLAVMATAIVKETASIKHAVSIINSMDMGKFPRLL------------------SRIFQKLH 103

  Fly    58 TTGRVDSSTEENPTSNTEPEYTLEELERLVGVPRQDFLLLIKTFSYILRRISTFIIKPSLLQREL 122
            .......|.||.           |:|:....:.:||..|:::|.|:||.:.....:|.::|:::|
 Frog   104 LKAERSFSEEEE-----------EKLQAAFALDKQDLNLVLETISFILEQAVYHNLKATVLRQQL 157

  Fly   123 REKLQLEDEAKIDAILRLWVRETTPIMNNLASKRYESNVIEDVAWKLNMEISSHCQQREKTPLAV 187
             |.:.|| ::|::|.:..|.......:.....:......:|..||:||::::...|.:.|:|.||
 Frog   158 -ENIHLE-QSKVEAFVNAWEISGQDTVEKFRQRILAPKKLETTAWQLNLQMAQSTQAKMKSPQAV 220

  Fly   188 LQMKTAVGEDINI 200
            :::..: .||..:
 Frog   221 IELGVS-SEDTKV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VletNP_572738.1 Commd10 12..224 CDD:240106 39/189 (21%)
commd10XP_031757047.1 Commd10 76..230 CDD:240106 38/185 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11534
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5109
OMA 1 1.010 - - QHG54546
OrthoDB 1 1.010 - - D1549928at2759
OrthoFinder 1 1.000 - - FOG0012551
OrthoInspector 1 1.000 - - oto102731
Panther 1 1.100 - - LDO PTHR12333
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.080

Return to query results.
Submit another query.