DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vlet and Commd10

DIOPT Version :9

Sequence 1:NP_572738.1 Gene:Vlet / 32116 FlyBaseID:FBgn0030323 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_006526287.1 Gene:Commd10 / 69456 MGIID:1916706 Length:254 Species:Mus musculus


Alignment Length:178 Identity:43/178 - (24%)
Similarity:82/178 - (46%) Gaps:16/178 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SPSVASASATSSTVGTSVTTTGRVDSSTEENPTSNTEPEYTLEELERL---VGVPRQDFLLLIKT 100
            |||:..|....:.:.|.  ...|:.|...:......|..::.||.|:|   ..:.:|:..|:::|
Mouse    12 SPSMKKAVPLINAIDTG--RFPRLLSRILQKLHLKAESSFSEEEEEKLQAAFSLEKQELHLVLET 74

  Fly   101 FSYILRRISTFIIKPSLLQRELREKLQLEDEAKIDAILRLWVRETTPIMNNLASKRYESNVIEDV 165
            .|::|.:.....:||:.||::| |.:.|..: |.:|....|.......:.....:....:.:|.|
Mouse    75 ISFVLEQAVYHNVKPAALQQQL-EMIHLRKD-KAEAFASAWSAMGQETVEKFRQRILGPHKLETV 137

  Fly   166 AWKLNMEISSHCQQREKTPLAVLQMKTA--------VGEDINIEMTQP 205
            .|:||::::...|.:.::|.||||:..:        |..| :|..|.|
Mouse   138 GWQLNLQMAHSAQAKLQSPQAVLQLGVSKEDAKFQTVSSD-HIHPTSP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VletNP_572738.1 Commd10 12..224 CDD:240106 43/178 (24%)
Commd10XP_006526287.1 Commd10 15..174 CDD:240106 35/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849370
Domainoid 1 1.000 47 1.000 Domainoid score I12009
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5329
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54546
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012551
OrthoInspector 1 1.000 - - oto92427
orthoMCL 1 0.900 - - OOG6_108097
Panther 1 1.100 - - LDO PTHR12333
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5031
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.890

Return to query results.
Submit another query.