DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vlet and Commd4

DIOPT Version :9

Sequence 1:NP_572738.1 Gene:Vlet / 32116 FlyBaseID:FBgn0030323 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_079693.1 Gene:Commd4 / 66199 MGIID:1913449 Length:199 Species:Mus musculus


Alignment Length:140 Identity:32/140 - (22%)
Similarity:59/140 - (42%) Gaps:10/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DFLLLIKTFSYILRRISTFIIKPSLLQRELREKLQLEDEAKIDAILRLWVRETTPIMNNLASKRY 157
            |....:...|:||...:...:....|..|| ::|.|..| ...::.|.:..:.:|:..:|.:...
Mouse    64 DVKATVAVLSFILSSAAKHSVDSDSLSSEL-QQLGLPKE-HATSLCRCYEEKQSPLQEHLRACSL 126

  Fly   158 ESNVIEDVAWKLNMEISSHCQQREKTPLAVLQMKT--AVGEDINIEMTQPELMEL-YNQFESIQG 219
            ..|.:..|.|:::..:||......:.|:..||::.  |.|     ...||..|.| .::|:.:..
Mouse   127 RVNRLASVGWRVDYTLSSSLLHSVEEPMVHLQLQVVPAPG-----TQAQPVSMSLSADKFQVLLA 186

  Fly   220 ELDAMLAMKT 229
            ||.....|.|
Mouse   187 ELKQAQTMMT 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VletNP_572738.1 Commd10 12..224 CDD:240106 30/133 (23%)
Commd4NP_079693.1 Commd4 25..198 CDD:240100 32/140 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.