DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vlet and commd10

DIOPT Version :9

Sequence 1:NP_572738.1 Gene:Vlet / 32116 FlyBaseID:FBgn0030323 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001017895.1 Gene:commd10 / 550594 ZFINID:ZDB-GENE-050417-454 Length:198 Species:Danio rerio


Alignment Length:206 Identity:47/206 - (22%)
Similarity:99/206 - (48%) Gaps:36/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SPSVASASATSSTVGTSVTTTGRVDSS--------------TEENPTSNTEPEYTLEELERLVGV 89
            :||:.:|          ||....:|:|              .:|...|..|.    |:|:..:.:
Zfish     8 TPSIKAA----------VTHINSIDNSKFSRLLTRILQKLHLKERSFSQEEE----EKLQSALSL 58

  Fly    90 PRQDFLLLIKTFSYILRRISTFIIKPSLLQRELREKLQLEDEAKIDAILRLWVRETTPIMNNLAS 154
            .|....||::|.|:||.:.:...:||:.|:::| |.:.:..: |.:...::|..:...::..:..
Zfish    59 ERHTLQLLLETVSFILEQAAYHNVKPASLRQQL-ENICISPQ-KAEVFSQMWAADAADLLEKIRL 121

  Fly   155 KRYESNVIEDVAWKLNMEISSHCQQREKTPLAVLQMKTAVG------EDINIEMTQPELMELYNQ 213
            ..:....::.|:|:||::::...:.|.|.|.|||.:.....      :|:.:|.:..:|:|.|||
Zfish   122 GIFAPMKLDRVSWQLNLQMARSDESRLKAPHAVLNLGLRAEDHSERLQDVFLEFSHQDLLEFYNQ 186

  Fly   214 FESIQGELDAM 224
            .|::|.:||::
Zfish   187 METVQTQLDSL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VletNP_572738.1 Commd10 12..224 CDD:240106 47/204 (23%)
commd10NP_001017895.1 Commd10 11..197 CDD:240106 45/201 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1549928at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.