DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vlet and COMMD4

DIOPT Version :9

Sequence 1:NP_572738.1 Gene:Vlet / 32116 FlyBaseID:FBgn0030323 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_024305736.1 Gene:COMMD4 / 54939 HGNCID:26027 Length:252 Species:Homo sapiens


Alignment Length:98 Identity:22/98 - (22%)
Similarity:44/98 - (44%) Gaps:5/98 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 AILRLWVRETTPIMNNLASKRYESNVIEDVAWKLNMEISSHCQQREKTPLAVLQMKTAVGEDINI 200
            ::.|.:..:.:|:..:|.......|.:..|.|:::..:||...|..:.|:..|:::.|....   
Human   158 SLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPG--- 219

  Fly   201 EMTQPELMEL-YNQFESIQGEL-DAMLAMKTTG 231
            ...||..|.| .::|:.:..|| .|...|.:.|
Human   220 TPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VletNP_572738.1 Commd10 12..224 CDD:240106 19/89 (21%)
COMMD4XP_024305736.1 Commd4 25..251 CDD:240100 21/95 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.