DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vlet and Commd10

DIOPT Version :9

Sequence 1:NP_572738.1 Gene:Vlet / 32116 FlyBaseID:FBgn0030323 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001004276.1 Gene:Commd10 / 361323 RGDID:1303015 Length:202 Species:Rattus norvegicus


Alignment Length:199 Identity:50/199 - (25%)
Similarity:99/199 - (49%) Gaps:22/199 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SPSVASASATSSTVGTSVTTTGRVDSSTEENPTSNTEPEYTLEELERL---VGVPRQDFLLLIKT 100
            |||:..|....:.:.|.  ...|:.|...:......|..::.||.|:|   ..:.:|:..|:::|
  Rat    12 SPSMKKAVPLINAIDTG--RFPRLLSRILQKLHLKAESSFSEEEEEKLQAAFSLEKQELHLVLET 74

  Fly   101 FSYILRRISTFIIKPSLLQRELREKLQLEDEAKIDAILRLWVRETTPIMNNLASKRYESNV---- 161
            .|::|.:.....:||::||::| |.:.|..: |.:|....|     ..|.:...:::...:    
  Rat    75 ISFVLEQAVYHNVKPAVLQQQL-ETIHLTQD-KAEAFANAW-----STMGHETVEKFRQRILGPL 132

  Fly   162 -IEDVAWKLNMEISSHCQQREKTPLAVLQMKTAVGEDIN-----IEMTQPELMELYNQFESIQGE 220
             :|.|.|:||::::...|.:.::|.||||:..:..:..|     :|....||.:.||:.|:||.:
  Rat   133 KLETVGWQLNLQMAHSAQAKLQSPQAVLQLGVSKEDSKNLEKVLVEFNHKELFDFYNKLETIQAQ 197

  Fly   221 LDAM 224
            ||::
  Rat   198 LDSL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VletNP_572738.1 Commd10 12..224 CDD:240106 50/197 (25%)
Commd10NP_001004276.1 Commd10 15..201 CDD:240106 47/194 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352994
Domainoid 1 1.000 47 1.000 Domainoid score I11770
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5255
OMA 1 1.010 - - QHG54546
OrthoDB 1 1.010 - - D1549928at2759
OrthoFinder 1 1.000 - - FOG0012551
OrthoInspector 1 1.000 - - oto95992
orthoMCL 1 0.900 - - OOG6_108097
Panther 1 1.100 - - LDO PTHR12333
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.870

Return to query results.
Submit another query.