DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vlet and Commd5

DIOPT Version :9

Sequence 1:NP_572738.1 Gene:Vlet / 32116 FlyBaseID:FBgn0030323 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_620808.1 Gene:Commd5 / 245974 RGDID:621468 Length:224 Species:Rattus norvegicus


Alignment Length:132 Identity:32/132 - (24%)
Similarity:61/132 - (46%) Gaps:16/132 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ERLVGVPRQDFLLLIKTFSYILR--RISTFIIKPSLLQRELREKLQLEDEAKIDAILRLWVRETT 146
            |||.       :||..|.:.:.:  |:....:||...|.||:| |.:..:. |..:..|......
  Rat    80 ERLA-------VLLAGTHTLLQQALRLPPASLKPDAFQEELQE-LGIPQDL-IGDLASLAFGSQR 135

  Fly   147 PIMNNLASKRYESNVIEDVA---WKLNMEISSHCQQREKTPLAVLQMKTAVGEDINIEMTQPELM 208
            |:::::|.::..|  :..|:   |::::.||:..|.|...|..::|:|...|.....|:...:..
  Rat   136 PLLDSVAQQQGSS--LPHVSYFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQ 198

  Fly   209 EL 210
            ||
  Rat   199 EL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VletNP_572738.1 Commd10 12..224 CDD:240106 32/132 (24%)
Commd5NP_620808.1 Commd5_HCaRG 115..224 CDD:240101 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.