DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp10D and PTP1

DIOPT Version :9

Sequence 1:NP_996413.2 Gene:Ptp10D / 32115 FlyBaseID:FBgn0004370 Length:1990 Species:Drosophila melanogaster
Sequence 2:NP_010051.1 Gene:PTP1 / 851368 SGDID:S000002389 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:332 Identity:103/332 - (31%)
Similarity:159/332 - (47%) Gaps:80/332 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1258 AEHYRLMSADSD----FRFSEEFEELKHVGRDQPCTFADL-----------PCNRPKNRFTNILP 1307
            |..:.:...|:|    |:|.:..|:    ||.:..|...:           |.|..:||:.||:|
Yeast     3 AAPWYIRQRDTDLLGKFKFIQNQED----GRLREATNGTVNSRWSLGVSIEPRNDARNRYVNIMP 63

  Fly  1308 YDHSRFKLQPVDDDEGSDYINANY----VPGHN-SPREFIVTQGPLHSTRDDFWRMCWES---NS 1364
            |:.:|..|:.:   .|:|||||:|    |||.: .|..:|.||||...|.|.||:||:.:   ::
Yeast    64 YERNRVHLKTL---SGNDYINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQFWQMCYHNCPLDN 125

  Fly  1365 RAIVMLTRCFEKGREKCDQYWP----NDTVPV---------------FYGDIKVQILNDSHYAD- 1409
            ..|||:|...|..||||.||||    :|||.:               |..|:|::.:|.....| 
Yeast   126 IVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDY 190

  Fly  1410 WVMTEFMLCRG----SEQRILRHFHFTTWPDFGVPNPPQTLVRFVR--AFRDRIGAEQRPIVVHC 1468
            :.:|:..|...    ...:.:.||:|..|.|.   |.|:.:|..:.  |....:.:...||:|||
Yeast   191 YTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDM---NKPEEVVPIMELCAHSHSLNSRGNPIIVHC 252

  Fly  1469 SAGVGRSGTFITLDRILQQINTSDYVDIF-------------------GIVYAMRKERVWMVQTE 1514
            ||||||:||||.||.::.  :|.|:.:|.                   .||..:|.:|:.||||:
Yeast   253 SAGVGRTGTFIALDHLMH--DTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTK 315

  Fly  1515 QQYICIH 1521
            .|::.|:
Yeast   316 DQFLFIY 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp10DNP_996413.2 fn3 124..205 CDD:278470
fn3 220..304 CDD:278470
fn3 315..391 CDD:278470
FN3 405..494 CDD:238020
FN3 511..574 CDD:238020
FN3 583..671 CDD:238020
fn3 683..753 CDD:278470
fn3 787..850 CDD:278470
fn3 866..935 CDD:278470
fn3 961..1043 CDD:278470
PTPc 1272..1525 CDD:214550 99/314 (32%)
PTPc 1298..1525 CDD:238006 92/277 (33%)
PTP1NP_010051.1 COG5599 1..335 CDD:227886 103/332 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I1104
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46470
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3031
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.