DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp10D and PTPRD

DIOPT Version :9

Sequence 1:NP_996413.2 Gene:Ptp10D / 32115 FlyBaseID:FBgn0004370 Length:1990 Species:Drosophila melanogaster
Sequence 2:NP_001364887.1 Gene:PTPRD / 5789 HGNCID:9668 Length:1932 Species:Homo sapiens


Alignment Length:1687 Identity:399/1687 - (23%)
Similarity:647/1687 - (38%) Gaps:445/1687 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PPFGYPEPNTTIASREIGDEIQFSRALPGTKYNFWLYYTN--FTHHDWLTWTVTITTAPDPPSNL 129
            |.|..|..|..|              :||...|.......  ..:..|:.....:|...|.|   
Human   236 PRFSIPPTNHEI--------------MPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMP--- 283

  Fly   130 SVQVRSGKNAIILWSPPTQGSYTAFKIKVLGLSEASSSYNRTFQVNDNTFQHSVKELTPGATYQV 194
                 .|:|.:.|.......:||...:..||:.||.:             |.:||.|        
Human   284 -----IGRNVLELNDVRQSANYTCVAMSTLGVIEAIA-------------QITVKAL-------- 322

  Fly   195 QAYTIYDGKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPPYPAGIYTHYKVSIEPPDAN 259
                                  |..||..:|.....|::.:.|....|..: ::|.:..:|  .|
Human   323 ----------------------PKPPGTPVVTESTATSITLTWDSGNPEPV-SYYIIQHKP--KN 362

  Fly   260 DSVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTMSEDEISLPTTAQYRTVPLRPLNVTFDRDF 324
            ...||.|.:|             |....|:::                                 
Human   363 SEELYKEIDG-------------VATTRYSVA--------------------------------- 381

  Fly   325 ITSNSFRVLWEAPKGISEFDKYQVSVATTRRQSTVPRSNEPVAFFDFRDIAEPGKTFNVIVKTVS 389
                          |:|.:..|:..|.........|.|             ||     |:.:|..
Human   382 --------------GLSPYSDYEFRVVAVNNIGRGPPS-------------EP-----VLTQTSE 414

  Fly   390 GKVTSWPATGDVTLRPLPVRNLRSINDDKTNTMIITWE--ADPASTQDEYRIVY--HELETFNGD 450
            ...:|.|.  ||..|.|           .:.|:::.|:  .:|......||:.|  ...:..|..
Human   415 QAPSSAPR--DVQARML-----------SSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNW 466

  Fly   451 TSTLTTDRTRFTLESLLPGRNYSLSVQAVSKKMESNETS-IFVVTR---PSSPIIEDLKS---IR 508
            ......|....|:.:|:|.:.||:.|.|.:...:...:| |.|:|:   |..|:  :.|:   ..
Human   467 MKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPL--NFKAEPESE 529

  Fly   509 MGLNISWKSDVNSKQEQYEVLYSRNGTSDLRTQKTKESRLVI--------KNLQPGAGYELKVFA 565
            ..:.:||....:.....||::| ::|      :..:|.|:.|        :.|:|.:.|..::.|
Human   530 TSILLSWTPPRSDTIANYELVY-KDG------EHGEEQRITIEPGTSYRLQGLKPNSLYYFRLAA 587

  Fly   566 VS-------------HDLRSEPHAYFQAVYPNPPRNMTIETVRSNSVLVHWSPP----ESGEFTE 613
            .|             ..::|:|.|        ||::::..:..|.|:||.|.||    ::|..||
Human   588 RSPQGLGASTAEISARTMQSKPSA--------PPQDISCTSPSSTSILVSWQPPPVEKQNGIITE 644

  Fly   614 YSIRY-----RTDSEQQWVRLPSVRSTEADITDMTKGEKYTIQVNT---VSFGVES-PVPQEVNT 669
            |||:|     ..|...:.:.:|| .:|:..:..:.|..:|.|.|..   |..|.|| .|....|.
Human   645 YSIKYTAVDGEDDKPHEILGIPS-DTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSVLIRTNE 708

  Fly   670 TVPPNPVSNI-IQLVDSRNITLEWPKP-----EGRVESYILKWWPSDNPGRVQTKNVSENKSADD 728
            .||..|...: ::.|:|.::.:.|..|     .|::..|.:.:...:|         .|.|....
Human   709 DVPSGPPRKVEVEAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMEN---------GEPKGQPM 764

  Fly   729 LSTVRVLIGELMPGVQYKFDIQTTSYGILSGI---------TSLY------PRTMPLIQSDVVVA 778
            |..|      ::...|::||..|....|:||:         .:.|      .|:.|.:.|.....
Human   765 LKDV------MLADAQWEFDDTTEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAV 823

  Fly   779 NGE-----KEDERDTITLSYTPTPQSSSKFDIYRFSLGDAEIRDKEKLA----NDTDRKVTFTGL 834
            .|:     ...:.:|..:.:.|...:......||...|.   :|.|.|.    ::.:...|.|.:
Human   824 PGKPRLVINHTQMNTALIQWHPPVDTFGPLQGYRLKFGR---KDMEPLTTLEFSEKEDHFTATDI 885

  Fly   835 VPGRLYNITVWTVSGG---------VASLPIQRQDRLYPEPI-----TQLHATNITDTEISLRWD 885
            ..|..|   |:.:|..         |..:.|       ||.:     ..||:...|.|.:.|.|.
Human   886 HKGASY---VFRLSARNKVGFGEEMVKEISI-------PEEVPTGFPQNLHSEGTTSTSVQLSWQ 940

  Fly   886 LP-----KG-------EYNDFDIAYLTADNLLAQNMTTRNEITISDLRPHRNYTFTVVVRSGTES 938
            .|     .|       .|.|.:|..|..:.|:....||   :|::.|:|  :.|:.|.||:.|. 
Human   941 PPVLAERNGIITKYTLLYRDINIPLLPMEQLIVPADTT---MTLTGLKP--DTTYDVKVRAHTS- 999

  Fly   939 SVLRSSSPLSAS--FTT---NEAVPGRVERFHPTDVQPSEINFEWSLPSSEANGVIRQFSIAYTN 998
               :...|.|.|  |.|   ::||  ..:.||...|..:.:...|.:|.:..:.:  .|.|.|  
Human  1000 ---KGPGPYSPSVQFRTLPVDQAV--FAKNFHVKAVMKTSVLLSWEIPENYNSAM--PFKILY-- 1055

  Fly   999 INNLTDAG--MQDFESEEAFGVIKNLKPGETYVFKIQAK-TAIGFGPEREYRQTMPILAPPRPA- 1059
                 |.|  :::.:......:|.||||.::|.|.:..: .:.|....|...:|.|.:...:|| 
Human  1056 -----DDGKMVEEVDGRATQKLIVNLKPEKSYSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPAF 1115

  Fly  1060 ----------TQVVPTEVYRSSSTIQIRFRKNYFSDQNGQVRMYTIIVAEDDAKNASGLEMPSW- 1113
                      |..:| ||                 ..|..::.|.||:.  ..|.:.|..:..| 
Human  1116 IGKTNLDGMITVQLP-EV-----------------PANENIKGYYIIIV--PLKKSRGKFIKPWE 1160

  Fly  1114 ------LDVQSYSVWLPYQAI--------DPYYP--FENRSVEDFTIGTENCDNHKIGYCNGPLK 1162
                  ||.....:....::|        .||..  |:....| ||:|.   |.|..|:.|..|:
Human  1161 SPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVLPTE-FTLGD---DKHYGGFTNKQLQ 1221

  Fly  1163 SGTTYRVKVRA--------FTGADKFTDTAYSF-----PIQTDQDNTSLIVAITVPLTIILVLLV 1214
            ||..|...|.|        ......::|...|.     ||..:::....:|...:.:..|:.:::
Human  1222 SGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEEGLIWVVGPVLAVVFIICIVI 1286

  Fly  1215 TLLFYKRRRNNCRKTTKDSRAN---DNMSLP------------------------------DSVI 1246
            .:|.||..:.:.::...|||.:   :|..:|                              .|.:
Human  1287 AILLYKSSKPDRKRAESDSRKSSIPNNKEIPSHHPTDPVELRRLNFQTPGSDDSGYPGNLHSSSM 1351

  Fly  1247 EQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVGRDQPCTFADLPCNRPKNRFTNILPYDHS 1311
            ..:.||.|...|:|...:.|:.:.:||:|:|.: ..|:......::|..|:||||:.|::.||||
Human  1352 ASHPPIPILELADHIERLKANDNLKFSQEYESI-DPGQQFTWEHSNLEVNKPKNRYANVIAYDHS 1415

  Fly  1312 RFKLQPVDDDEGSDYINANYVPGHNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIVMLTRCFEK 1376
            |..|..::...||||:||||:.|:.....:|.|||.|..|..|||||.||..|..:||:|:..|:
Human  1416 RVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEER 1480

  Fly  1377 GREKCDQYWPNDTVPVFYGDIKVQILNDSHYADWVMTEFMLCR--GSEQRILRHFHFTTWPDFGV 1439
            .|.|||||||:..... :|.::|.:|:....|.:.:..|.|.:  .||:|.:|.|.||.|||.||
Human  1481 SRVKCDQYWPSRGTET-HGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGV 1544

  Fly  1440 PNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQINTSDYVDIFGIVYAMR 1504
            |..|...:.|:|..:.....:..|:||||||||||:|.||.:|.:|::|.....|||:|.|..||
Human  1545 PEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMR 1609

  Fly  1505 KERVWMVQTEQQYICIHQCLL-AVLEGKENIVGPAREMHDNEGYEGQQVQLDENGDVVATIE 1565
            .:|.:|||||.|||.||..|| ||..|...:  |||.::   .|..:..|: |.|:.|..:|
Human  1610 AQRNYMVQTEDQYIFIHDALLEAVTCGNTEV--PARNLY---AYIQKLTQI-ETGENVTGME 1665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp10DNP_996413.2 fn3 124..205 CDD:278470 15/80 (19%)
fn3 220..304 CDD:278470 15/83 (18%)
fn3 315..391 CDD:278470 10/75 (13%)
FN3 405..494 CDD:238020 19/93 (20%)
FN3 511..574 CDD:238020 15/83 (18%)
FN3 583..671 CDD:238020 30/100 (30%)
fn3 683..753 CDD:278470 15/74 (20%)
fn3 787..850 CDD:278470 14/66 (21%)
fn3 866..935 CDD:278470 22/85 (26%)
fn3 961..1043 CDD:278470 18/84 (21%)
PTPc 1272..1525 CDD:214550 110/254 (43%)
PTPc 1298..1525 CDD:238006 103/228 (45%)
PTPRDNP_001364887.1 I-set 24..115 CDD:400151
Ig strand A' 32..36 CDD:409353
Ig strand B 39..48 CDD:409353
Ig strand C 54..59 CDD:409353
Ig strand C' 62..65 CDD:409353
Ig strand D 68..75 CDD:409353
Ig strand E 76..86 CDD:409353
Ig strand F 94..102 CDD:409353
Ig strand G 105..115 CDD:409353
IgI_2_RPTP_IIa_LAR_like 127..226 CDD:409400
Ig strand B 143..147 CDD:409400
Ig strand C 156..160 CDD:409400
Interaction with IL1RAPL1. /evidence=ECO:0000250 180..189
Mini-exon peptide A9, sufficient for interaction with IL1RAPL1. /evidence=ECO:0000250|UniProtKB:Q64487 181..189
Ig strand E 190..194 CDD:409400
Ig strand F 204..209 CDD:409400
Ig strand G 216..219 CDD:409400
Mini-exon peptide B, required for interaction with SLITRK2 and in the function in pre-synaptic differentiation, Acts as an adjustable linker to control relative positions and orientations of the PTPRD second and third immunoglobilin domains for their simultaneous interactions with the first immunoglobilin domain of IL1RAPL1 and IL1RAP, Modulates affinity for IL1RAPL1 and IL1RAP. /evidence=ECO:0000250|UniProtKB:Q64487 227..230
IgI_3_RPTP_IIa_LAR_like 239..320 CDD:409401 20/115 (17%)
Ig strand B 253..257 CDD:409401 1/3 (33%)
Ig strand C 266..270 CDD:409401 0/3 (0%)
Ig strand E 287..291 CDD:409401 1/3 (33%)
Ig strand F 299..304 CDD:409401 2/4 (50%)
Ig strand G 312..315 CDD:409401 2/2 (100%)
FN3 323..412 CDD:238020 25/169 (15%)
FN3 419..511 CDD:238020 24/104 (23%)
FN3 516..604 CDD:238020 17/96 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 603..623 5/27 (19%)
FN3 612..706 CDD:238020 29/94 (31%)
FN3 713..819 CDD:238020 22/120 (18%)
FN3 824..919 CDD:238020 19/107 (18%)
FN3 922..1013 CDD:238020 27/99 (27%)
FN3 1023..>1084 CDD:238020 16/69 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1304..1324 5/19 (26%)
R-PTPc-D-1 1354..1637 CDD:350472 120/284 (42%)
Substrate binding. /evidence=ECO:0000250 1573..1579 5/5 (100%)
R-PTP-D-2 1638..1929 CDD:350476 9/34 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3031
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.