| Sequence 1: | NP_996413.2 | Gene: | Ptp10D / 32115 | FlyBaseID: | FBgn0004370 | Length: | 1990 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005173575.1 | Gene: | ephb6 / 572411 | ZFINID: | ZDB-GENE-100922-51 | Length: | 1003 | Species: | Danio rerio |
| Alignment Length: | 195 | Identity: | 50/195 - (25%) |
|---|---|---|---|
| Similarity: | 77/195 - (39%) | Gaps: | 31/195 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 880 ISLRWDLPKGEYNDFDIAY----------------------LTADNLLAQNMTTRNEITISDLRP 922
Fly 923 HRNYTFTVVVRSGTESSVLRSSSPLSAS--FTTNEAVPGRVERFHPTDVQPSEINFEWSLPSSEA 985
Fly 986 NGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVFKIQAKTAIGFGPEREYRQTM 1050
Fly 1051 1050 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ptp10D | NP_996413.2 | fn3 | 124..205 | CDD:278470 | |
| fn3 | 220..304 | CDD:278470 | |||
| fn3 | 315..391 | CDD:278470 | |||
| FN3 | 405..494 | CDD:238020 | |||
| FN3 | 511..574 | CDD:238020 | |||
| FN3 | 583..671 | CDD:238020 | |||
| fn3 | 683..753 | CDD:278470 | |||
| fn3 | 787..850 | CDD:278470 | |||
| fn3 | 866..935 | CDD:278470 | 14/76 (18%) | ||
| fn3 | 961..1043 | CDD:278470 | 22/81 (27%) | ||
| PTPc | 1272..1525 | CDD:214550 | |||
| PTPc | 1298..1525 | CDD:238006 | |||
| ephb6 | XP_005173575.1 | Ephrin_lbd | 22..212 | CDD:279712 | |
| GCC2_GCC3 | <286..321 | CDD:285001 | |||
| FN3 | 342..437 | CDD:214495 | 14/79 (18%) | ||
| FN3 | 473..550 | CDD:238020 | 23/79 (29%) | ||
| EphA2_TM | <591..636 | CDD:291255 | |||
| PKc_like | 636..905 | CDD:304357 | |||
| Pkinase_Tyr | 641..901 | CDD:285015 | |||
| SAM | 932..995 | CDD:197735 | |||
| SAM_superfamily | 932..987 | CDD:301707 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 50 | 1.000 | Domainoid score | I11636 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||