DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp10D and Pez

DIOPT Version :9

Sequence 1:NP_996413.2 Gene:Ptp10D / 32115 FlyBaseID:FBgn0004370 Length:1990 Species:Drosophila melanogaster
Sequence 2:NP_001260127.1 Gene:Pez / 33882 FlyBaseID:FBgn0031799 Length:1252 Species:Drosophila melanogaster


Alignment Length:332 Identity:81/332 - (24%)
Similarity:139/332 - (41%) Gaps:62/332 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1235 ANDNMSLPD---SVIEQNRPILIKNFAEHYRLMSAD----------SDFRFSEEFEELKHVGRDQ 1286
            |.|:::||:   :.:.:.:||     :..|   |.|          ||.:...|||.:.......
  Fly   941 AQDDLNLPNRWSTGVNKPQPI-----SGRY---SKDKLCQILDQKLSDSQLFMEFERIPKRREHA 997

  Fly  1287 PCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPG--HNSPREFIVTQGPLH 1349
            ....|.|..|.|||...|.||||.:|.:|.|..|:. ..|:||:.:..  ....|.:||.|.|..
  Fly   998 LYECALLEENEPKNHDPNFLPYDDNRVRLTPCRDNR-HGYVNASSISATVGTKQRFYIVAQSPQE 1061

  Fly  1350 S-TRDDFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP-NDTVPVFYGDIKVQILNDSHYADWVM 1412
            . |...||:..||::...:|.||...        .|.| |....:.:|..:|       |.::..
  Fly  1062 PLTMRIFWQCVWEADVYLVVQLTEDM--------SYIPRNSHQRLEFGQFQV-------YQEFSQ 1111

  Fly  1413 TEFMLCRGSEQRI-------LRHFHFTTWPDFGVPNPPQTLVRFVRAFRD----RIGAEQR---- 1462
            |... |...:.|:       .|...:..:.|:...|.|:.:..|:....:    |:.:.|.    
  Fly  1112 TTDR-CTTIKLRLYHVPSRRYRSVWYLQYADWAEQNCPRDVNHFLDFLEELNSVRLASTQEVPPG 1175

  Fly  1463 -----PIVVHCSAGVGRSGTFITLDRILQQINTSDYVDIFGIVYAMRKERVWMVQTEQQYICIHQ 1522
                 |:::||..|.||||..:|.|.:|..::.::.:||..::..:|.:|..::.:..||..|:.
  Fly  1176 HNTNPPVLLHCLEGGGRSGVTLTADLLLYTLDHNEDLDIPRVIGQLRHQRDSIIPSLAQYKFIYN 1240

  Fly  1523 CLLAVLE 1529
            .|:..|:
  Fly  1241 LLITYLK 1247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp10DNP_996413.2 fn3 124..205 CDD:278470
fn3 220..304 CDD:278470
fn3 315..391 CDD:278470
FN3 405..494 CDD:238020
FN3 511..574 CDD:238020
FN3 583..671 CDD:238020
fn3 683..753 CDD:278470
fn3 787..850 CDD:278470
fn3 866..935 CDD:278470
fn3 961..1043 CDD:278470
PTPc 1272..1525 CDD:214550 68/276 (25%)
PTPc 1298..1525 CDD:238006 62/250 (25%)
PezNP_001260127.1 B41 26..230 CDD:214604
FERM_N 26..93 CDD:286467
FERM_M 114..230 CDD:278785
FERM_C_PTPN14_PTPN21 225..317 CDD:270009
Y_phosphatase 1007..1243 CDD:278528 63/252 (25%)
PTPc 1009..1243 CDD:238006 62/250 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443507
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.