DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp10D and FNDC5

DIOPT Version :9

Sequence 1:NP_996413.2 Gene:Ptp10D / 32115 FlyBaseID:FBgn0004370 Length:1990 Species:Drosophila melanogaster
Sequence 2:NP_715637.2 Gene:FNDC5 / 252995 HGNCID:20240 Length:212 Species:Homo sapiens


Alignment Length:229 Identity:46/229 - (20%)
Similarity:88/229 - (38%) Gaps:60/229 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   576 AYFQAVYPNPPRNMTIETVRSNSVLVHWSPPESGEFTEYSIRYRTDSEQQWVR----LPSVRST- 635
            |..||..|:.|.|:|:..:::||.:|.|...|.    |..|.:....:::.||    :..|.:| 
Human    27 ALVQADSPSAPVNVTVRHLKANSAVVSWDVLED----EVVIGFAISQQKKDVRMLRFIQEVNTTT 87

  Fly   636 -EADITDMTKGEKYTIQVNTVSFGVESPVPQEVNTTVPPNPVSNIIQLVDSRNITLEWPKPEGRV 699
             ...:.|:.:..:|.:.|..:|...:||.                     |..:..:.|:...::
Human    88 RSCALWDLEEDTEYIVHVQAISIQGQSPA---------------------SEPVLFKTPREAEKM 131

  Fly   700 ESYILKWWPSDNPGRVQTKNVSENKSADDLSTVRVLIGELMPGVQYKFDIQTTSYGILSGITSLY 764
                    .|.|...|..|.:..|:        ::..||::..|...|        :.:|:.:|:
Human   132 --------ASKNKDEVTMKEMGRNQ--------QLRTGEVLIIVVVLF--------MWAGVIALF 172

  Fly   765 PRTMPLIQSDVVVANGEKEDERDTITLSYTPTPQ 798
            .|     |.|::..|....::..|.:.|.|.||:
Human   173 CR-----QYDIIKDNEPNNNKEKTKSASETSTPE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp10DNP_996413.2 fn3 124..205 CDD:278470
fn3 220..304 CDD:278470
fn3 315..391 CDD:278470
FN3 405..494 CDD:238020
FN3 511..574 CDD:238020
FN3 583..671 CDD:238020 21/93 (23%)
fn3 683..753 CDD:278470 11/69 (16%)
fn3 787..850 CDD:278470 5/12 (42%)
fn3 866..935 CDD:278470
fn3 961..1043 CDD:278470
PTPc 1272..1525 CDD:214550
PTPc 1298..1525 CDD:238006
FNDC5NP_715637.2 FN3 34..124 CDD:238020 22/114 (19%)
DUF4808 151..>203 CDD:318317 15/64 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.