DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp10D and il2rg

DIOPT Version :9

Sequence 1:NP_996413.2 Gene:Ptp10D / 32115 FlyBaseID:FBgn0004370 Length:1990 Species:Drosophila melanogaster
Sequence 2:XP_002934932.1 Gene:il2rg / 100492995 XenbaseID:XB-GENE-482340 Length:329 Species:Xenopus tropicalis


Alignment Length:246 Identity:57/246 - (23%)
Similarity:92/246 - (37%) Gaps:50/246 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   757 LSGI---------TSLYPRTMPLI----QSDVVVANGEKEDERDTITLSYTPTPQSSSKFDIYRF 808
            :|||         :||:..|..|:    |::.:..|.....|: ::|..:.....|...:.:|.:
 Frog     1 MSGIFYGNMRKMGSSLFIITFLLLNCCSQANSITVNCIVTQEK-SMTCMWNKEALSPENYSLYYW 64

  Fly   809 SLGDAEIRDKEKLANDTDRKVTFTGLVPGRLYNITVWTVSGGVASLP--------------IQR- 858
            ...|.     ...|....|.:...|:      ||..|..|..|.:..              :|| 
 Frog    65 YTSDG-----NTTAAPCTRYLQENGI------NIGCWFNSSAVRTFKEFNVRLNSSSKQEHVQRF 118

  Fly   859 ---QDRLYPEPITQLHATNITDTEISLRWDLPKGEYNDFDIAYLTADNLLAQNMTTRNEITISDL 920
               |:.:..||..:||..|.:|.|:.|.|:...|::.|..:.|......||.|..|...:||...
 Frog   119 RNLQNLVRLEPPVKLHVENRSDLELLLSWEPLLGQFKDHCLTYQVQYRSLASNSWTVKNVTIKQF 183

  Fly   921 R-P--HRNYTFTVVVRSGTE----SSVLRSSSPLSASFTTNEAVPGRVERF 964
            . |  .|:..:|..|||...    |:||.|...:..|:..|:..|.:...|
 Frog   184 SLPSYSRDKLYTFHVRSKLNELCASTVLWSEWSVGVSWGRNDTTPSKETSF 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp10DNP_996413.2 fn3 124..205 CDD:278470
fn3 220..304 CDD:278470
fn3 315..391 CDD:278470
FN3 405..494 CDD:238020
FN3 511..574 CDD:238020
FN3 583..671 CDD:238020
fn3 683..753 CDD:278470
fn3 787..850 CDD:278470 11/62 (18%)
fn3 866..935 CDD:278470 22/71 (31%)
fn3 961..1043 CDD:278470 1/4 (25%)
PTPc 1272..1525 CDD:214550
PTPc 1298..1525 CDD:238006
il2rgXP_002934932.1 FN3 37..111 CDD:389787 13/85 (15%)
FN3 128..221 CDD:238020 28/92 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.