DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPA3 and rpa3

DIOPT Version :9

Sequence 1:NP_001285131.1 Gene:RPA3 / 32113 FlyBaseID:FBgn0266421 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001016626.1 Gene:rpa3 / 549380 XenbaseID:XB-GENE-991987 Length:121 Species:Xenopus tropicalis


Alignment Length:114 Identity:30/114 - (26%)
Similarity:47/114 - (41%) Gaps:3/114 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DAFD-PRSIINGGMLKQFSGQTVSIMVRVESV--AGSTLLASSTDNHKLKINLPGELGAAEGAWV 63
            |.|| |:..||..||.|..|:.|..:.:||.|  .|::::.|........:.|...|.......:
 Frog     3 DLFDVPKVRINTSMLAQNVGRPVCFVGKVEKVHPTGTSIVVSDGAGKNATVELNEPLEEEISGII 67

  Fly    64 EVIGVPHGADTLRAKEVIEFGGENIDFDKDGYNGLSHLINNVKAFYRSG 112
            ||||......|:.....:.|..:...||...|:....:|:....:|..|
 Frog    68 EVIGKVTPKATIMGVSYVPFREDVSTFDLALYDEALKIIHEFPQYYPFG 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPA3NP_001285131.1 Rep_fac-A_3 1..109 CDD:400821 28/109 (26%)
rpa3NP_001016626.1 Rep_fac-A_3 6..113 CDD:370046 26/106 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1594928at2759
OrthoFinder 1 1.000 - - FOG0007241
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.