DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPA3 and ssb3

DIOPT Version :9

Sequence 1:NP_001285131.1 Gene:RPA3 / 32113 FlyBaseID:FBgn0266421 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_588128.1 Gene:ssb3 / 2538775 PomBaseID:SPCC23B6.05c Length:104 Species:Schizosaccharomyces pombe


Alignment Length:108 Identity:25/108 - (23%)
Similarity:45/108 - (41%) Gaps:10/108 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAFDPRSIINGGMLKQFSGQTVSIMVRVESVAGSTLLASSTDNHKLKINLPGELGAAEGAWVEV 65
            |:...||  :...||.:.||:||.|:.:...|.|.|....|..:..:.:.:...|  ....:.|.
pombe     1 MERPTPR--VTKDMLPECSGKTVRIVGKANQVEGETAKVDSNGSFDMHLTVDNTL--EPNHFYEF 61

  Fly    66 IGVPHGADTLRAKEVIEFGGENIDFDKDGYNGL---SHLINNV 105
            :.......:::....::||   .|.|.:.|..|   ||..|::
pombe    62 VVSVKPDSSVQLLTCVDFG---TDIDMEVYQKLVLFSHKYNSL 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPA3NP_001285131.1 Rep_fac-A_3 1..109 CDD:400821 25/108 (23%)
ssb3NP_588128.1 Rep_fac-A_3 1..102 CDD:285824 25/108 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZSS
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103793
Panther 1 1.100 - - LDO PTHR15114
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.