DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB1 and Antp

DIOPT Version :9

Sequence 1:NP_002135.2 Gene:HOXB1 / 3211 HGNCID:5111 Length:301 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:358 Identity:102/358 - (28%)
Similarity:128/358 - (35%) Gaps:97/358 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     1 MDYNRMNSFLEYPLCN-RGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQ----- 59
            |.|.|...:...|..| :|......|.. .|.|.|.:..|.....:.:..|.|..|..||     
  Fly    55 MPYPRFPPYDRMPYYNGQGMDQQQQHQV-YSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQ 118

Human    60 ----NSGYPAQQPPSTLGVPFP------------SSAPSGYAPAACSPSYGPSQYYPLGQS---- 104
                .....|||.|..|....|            ...|..||......:.|.....|.|.|    
  Fly   119 PSQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLV 183

Human   105 -EGDGGYF-----------HPSSYGAQLG----GLSD-------GYGAG------GAGPGPYPPQ 140
             :..|.:.           ||.   ||||    |:.|       .:..|      |..|...|||
  Fly   184 DQMSGHHMNAQMTLPHHMGHPQ---AQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQ 245

Human   141 ---HPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPT----ARTFDWMKVKRNPPKTAKVSEP 198
               |...|..|.....|.        :.||....||:.:    :..:.||:     .:..|..|.
  Fly   246 GMMHQGQGPPQMHQGHPG--------QHTPPSQNPNSQSSGMPSPLYPWMR-----SQFGKCQER 297

Human   199 GLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKRER 263
            ..|     |..:|..|..|||||||||:||:|.||:|||..|.|.|.|:||||||||||.||..:
  Fly   298 KRG-----RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENK 357

Human   264 EEGRVPPAPPGCPKEAAGDASDQSTCTSPEASP 296
            .:|.     ||     :|...|:.|   |..||
  Fly   358 TKGE-----PG-----SGGEGDEIT---PPNSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB1NP_002135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..77 15/65 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..149 8/30 (27%)
Antp-type hexapeptide 179..184 1/4 (25%)
Homeobox 207..259 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..301 15/43 (35%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 33/165 (20%)
Homeobox 301..354 CDD:395001 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.