DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB1 and unpg

DIOPT Version :9

Sequence 1:NP_002135.2 Gene:HOXB1 / 3211 HGNCID:5111 Length:301 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:277 Identity:86/277 - (31%)
Similarity:107/277 - (38%) Gaps:81/277 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    53 SSPAFQQNSGYPAQQPPSTLGVPFPSSAPSGYAPA-ACSPSYGPSQYYPL------------GQS 104
            ||||     |:||.|.|.....|.|   |..:.|. |......|:..:||            |.:
  Fly   112 SSPA-----GHPAAQQPQAQAQPQP---PPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVA 168

Human   105 EGD-----------GGYFHPSSYGAQLGGLSDGYGAGG------AGPG------PYPPQ--HPPY 144
            ..|           ..|.|..|..|:|..::    |.|      |.||      |.|||  ..|.
  Fly   169 PTDLSYRRLAELMNQDYVHSLSVHARLQHMA----AAGRMHEDQANPGMAQLQEPTPPQAHSSPA 229

Human   145 GNEQTASFAPAYADLLSEDKE---TPCPSEPNTPTARTFDW-MKVKRNPPKTAKVSE-------- 197
            .:...:...||....:.||.|   ..|.....|.:.|.::. |...||...|...||        
  Fly   230 KSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGA 294

Human   198 --------------PGLGSPSG-----LRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELN 243
                          .|.||.|.     .||.||:.||.|||:|||..||||...|.:||.:|:|:
  Fly   295 QSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLS 359

Human   244 ETQVKIWFQNRRMKQKK 260
            |.||||||||||.|.|:
  Fly   360 EVQVKIWFQNRRAKWKR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB1NP_002135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..77 10/23 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..149 10/35 (29%)
Antp-type hexapeptide 179..184 0/5 (0%)
Homeobox 207..259 CDD:278475 33/51 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..301 4/7 (57%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/50 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.